KEGG   Planctomyces limnophilus: Plim_0694Help
Entry
Plim_0694         CDS       T01225                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
plm  Planctomyces limnophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plim_0694
DNA repair and recombination proteins [BR:plm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Plim_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
912941..913564
Genome map
AA seq 207 aa AA seqDB search
MPRAIEPNHHAYGRHVGLLVQQLAALPGIGQKSAERLAQHLLDCSEEEAAALAHAILDVR
RTIRRCSVCHNLTEQETCDICLDSRRDQGLVCIVEQPRDLLALEATGTFGGVYHVLGGRI
APLSGVGPDDLNLATLIRRVKAGKIRELVMATNPTLEGDGTALYIVNLLADEPVKITRLA
RGIATGSVLEFANREMLSDALKGRQSF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccattgaaccgaatcatcatgcgtatggccgacatgtcggtctgcttgtt
cagcaactggcggctctcccggggattgggcagaagtcggcggagcggctggcacagcat
cttctcgattgctctgaggaagaagcggctgctcttgcccatgccattctggatgttcgc
cgcacaattcgtcgatgttcggtctgccacaatctgactgagcaggaaacttgcgacatc
tgcctcgattcaaggcgggatcagggattggtctgcattgtggagcaacctcgagacctt
ctggcgctggaggccaccggaacctttgggggcgtctaccatgtgctcggtggccgcatt
gcaccactgagtggtgtgggccccgatgatttgaacctcgccacgctcatccgccgtgtt
aaagccgggaagattcgcgaactggtaatggccacgaatcccactctcgaaggggatgga
accgccctgtacatagtgaatcttctggccgatgaaccggtcaaaatcactcgtctggca
cgcgggatcgccaccggcagtgtactggaatttgccaatcgcgagatgctttcggatgct
ctcaagggccgccagagcttttaa

DBGET integrated database retrieval system