KEGG   Planctomyces limnophilus: Plim_0810Help
Entry
Plim_0810         CDS       T01225                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
plm  Planctomyces limnophilus
Brite
Enzymes [BR:plm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Plim_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1046794..1047804)
Genome map
AA seq 336 aa AA seqDB search
MMQQRSLGVLTLILACGLSIHGPSTHLAVANNGPWPLPQVTSPANNPSTPEKVELGRQLF
FDPRLSKTQEVSCASCHNPEKGYSDGESNSQGIGGQRGNRNSPSIINSAYHKFQFWDGRS
KTLEEQALGPMQNPIEMGMTLDELVKRLNEVPGYRAQFQKVFGTDVTAENMAKAIAAFER
TIVSNNSPYDRFVAGDTTNWNPTLELGRALFFGKANCSACHSGANLTDNAFHNIGIGSQD
AGRAAISKLEADQGAFKTPTVREVARTAPYMHDGSLKTLEEVVEHYNKGGTPNDYLDEEI
FPLKLTDAEKAALVIFMREGLSSPDLPIITKPELPQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcaacgtagtttaggggttttgacattgattctggcctgcgggctttccatt
catggtccatcgactcatctggcagtcgcgaacaatggcccctggccactccctcaagtg
acttcaccagccaacaatccttcgacgccagaaaaagtcgaactgggtcggcaactcttc
ttcgacccccggctttcgaaaactcaggaagtctcttgcgccagttgccataatccggaa
aaagggtacagcgacggtgagtccaactctcaagggattggcggccagcgtggaaatcgg
aattccccttcgatcattaacagcgcgtaccacaagtttcagttctgggatggacgctcc
aagactctcgaagagcaagccctgggacccatgcagaacccgattgaaatggggatgaca
ctcgatgaactcgttaaacgtctgaatgaagtgccggggtatcgtgctcagttccagaaa
gtttttgggacggatgtcactgcggaaaacatggctaaggcgattgccgcttttgaaaga
actattgtttccaacaactcgccttatgaccgttttgttgccggcgatacgacaaactgg
aacccgacgctcgaactggggcgggctctcttcttcggaaaagccaattgcagtgcctgc
cacagcggagccaacctgactgataacgccttccataacatcggtattggcagccaggat
gcgggtcgtgctgcgatctccaagctggaagccgatcagggggccttcaaaactccgaca
gtaagagaagttgctcgtactgctccctacatgcatgatggcagtctcaagacactcgaa
gaagtggtcgagcattacaacaaagggggcactcccaacgattacctcgatgaagaaatc
ttcccgctcaagttgacggacgcagaaaaagcggctctggtcatcttcatgcgggaaggg
ttatccagcccggatcttcctattatcaccaagcccgaactcccccaataa

DBGET integrated database retrieval system