KEGG   Planctomyces limnophilus: Plim_0874Help
Entry
Plim_0874         CDS       T01225                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
plm  Planctomyces limnophilus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Plim_0874
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Plim_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1121946..1122713)
Genome map
AA seq 255 aa AA seqDB search
MPTCCVAAGGNIGDVAATFRQVWQILEQTPGIDGVIASRPYQTIPVGENAGDVFLNGAYR
FESTLPATVILNHLRTIEEQFGRSRSLAWGPRTIDLDLVIYGEDVIQLPQLSVPHPAAWY
RRFVLDPMAEIAGELVHPVHRVTFRRLQERLLELPLKVALGPLAEESEDRLSDLRWQLQQ
EFPQVQLMELSQAATADLILAGRVDVLETLGARLIGTTSTRLVDTAQRPVRTLAEVRHVL
LSATDSPQPLEPVCE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctgttgtgtggctgctggtggtaacattggagatgttgccgccacctttcga
caggtctggcagatactcgagcagactccaggtattgatggagtgatcgcaagccgccct
taccagacaatccccgtcggcgaaaacgcaggcgatgtctttctgaatggcgcttaccgc
ttcgaatcaactctcccggcaaccgtaattctcaatcatctacgcaccattgaggaacag
tttggccgatcacgatcactcgcctggggtcccagaacaatcgacctcgatctcgtgatc
tacggcgaagatgtcatccagctgccgcaactctcggttccgcatccggcggcctggtat
cgccgctttgtcctcgatcccatggccgaaatcgctggcgaactggtgcatcccgtccat
cgtgtcacttttcgaaggttgcaggagaggctcctcgaactgccgctcaaggtcgcgctg
gggccgcttgcagaagaaagcgaagaccggctttctgatctgcgatggcaacttcagcag
gagttcccgcaggttcaactgatggaactcagccaagccgcgactgcagatctgatcctg
gccggccgagtcgatgtcctcgaaacattgggtgccagactgattggcacaaccagcact
cgtctggtggatacagcccagcgacctgtgcgaactctggcagaagttcgtcatgtcctc
ctgtccgccacagactcgcctcaacccttagagccagtgtgcgaatga

DBGET integrated database retrieval system