KEGG   Planctopirus limnophilus: Plim_0928Help
Entry
Plim_0928         CDS       T01225                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
plm  Planctopirus limnophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_0928
   01230 Biosynthesis of amino acids
    Plim_0928
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_0928
  Energy metabolism
   00680 Methane metabolism
    Plim_0928
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plim_0928
Enzymes [BR:plm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Plim_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187910..1188515
Genome map
AA seq 201 aa AA seqDB search
MLLCRHGATAANEMRPYILQGCEMNGPLTAIGEAQARSLAAALSAFRIAGVYASPLQRAH
QTAEFIANSHQLKVETDANLRECSVGRWEGLDWETIRTKDKEAHDHFFADPATNPHPGGE
SYSDVLHRAEPTLKQLAERHQGENIVVVAHNMLNRVMLTPLLGLPLRLARQVKQANCCIN
VIEWTTDRAELITLNSVLHLD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtgccggcatggagcgacggctgcgaatgagatgcgtccctacattttgcag
gggtgtgaaatgaacgggccgctcacggcgattggtgaagcgcaagcccgatcgctcgcg
gcggcattgagtgcctttcgtattgcaggggtttatgcgagcccacttcagagggctcat
cagacagcagagttcattgcgaacagccatcagttgaaggtagagactgatgcgaactta
cgggaatgcagcgtcggtcgctgggaagggctcgactgggaaacgatccggacgaaggac
aaagaggctcacgatcatttttttgctgatcccgcaaccaatcctcacccggggggcgaa
tcctactctgatgtgcttcatcgtgctgagccgactctgaaacaactggctgagcggcat
cagggtgagaatattgtggtggtggctcacaatatgctcaatcgagtgatgctgacaccg
ctcttgggtttacctctccgcctggcgcgtcaggtcaagcaggccaattgctgtattaat
gtgatcgagtggacgactgaccgagccgaactgatcacgctcaacagtgtgcttcatctt
gattga

DBGET integrated database retrieval system