KEGG   Planctomyces limnophilus: Plim_1164Help
Entry
Plim_1164         CDS       T01225                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
plm  Planctomyces limnophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:plm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488668..1490095)
Genome map
AA seq 475 aa AA seqDB search
MVDRPQTVGQLRESGYRPQSVKDEMRKNLIRKLRSGENLFPGIVGYEETVTPQIVNAILS
RHDMLFLGLRGQGKTRILRSLTSLLDDALPMVAGSEIHDDPLAPLSKYARDRIAVEGDNC
PIDYVGAADRYFEKLATPDVTIADLIGEIDLVKHASGKELASEDVLHFGLIPRAHRGIFC
MNEVPDLSPKIQVGLFNVLEERDIQIRGFPIRLNLDVCIVFSANPEDYTNRGRIVTPLKD
RIGSVIRTHYPLTRELGMSITDQNAWTDRDSSTQVIVPTFLKEIVEETARLARQSPHVNQ
ASGVSVRMSIANYENLVSNAERRAIVQHEKLAVARTCDLNSMVSSSRGKLELSMSDESGE
EDKLLGRIIDEATKNIFDQHFNPKQFRNVVEHFDLGESIELGDGLSSEQTWQKLSAIRGF
SEQVEAAAKKLEPTLLEGATRTAVLASVAEFLLDGLYCSNRLSRQPRGTGLHYGK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggtggatcgtccccagacagttggtcaacttcgggaatcgggttatcgaccacagagc
gttaaggacgaaatgagaaagaacctcattcgtaaattgcgctcaggcgaaaatctgttt
ccgggaattgtcggctacgaggaaaccgtcacgccgcagatcgtcaacgcgattctttcc
cgtcacgatatgctctttctgggtctgagaggtcagggcaaaactcgcattctgaggtcg
ttaacgtcactgctggatgacgccttgcccatggtggcgggatcggaaattcatgatgac
cctttggcaccactttcgaagtatgcccgtgatcgaattgccgtcgaaggcgacaattgc
cccattgattatgtgggggccgcggatcgatactttgaaaagctggcgacgcctgatgtg
acgattgccgatctcatcggcgaaatcgatctcgttaaacatgcttcagggaaagagctt
gccagcgaagatgtacttcactttggactgatcccgcgtgctcatcgcggaatcttctgt
atgaacgaagtccccgacttaagccccaaaattcaggtgggattgtttaatgtgctcgaa
gagcgagacattcaaattcgcggatttccgatccgcctgaatctggatgtctgtatcgtc
ttcagtgcgaatccggaggattacacgaaccgagggcgaattgtcacccctctcaaggat
cgaattgggtctgtcattcgcacacattatcccctcacgcgtgaactgggaatgtcgatc
accgatcagaatgcctggacagatcgcgattcctctactcaagtgattgtgccgacattt
ctcaaagaaattgtcgaagaaacggctcgcctcgcacgccagagcccccatgtcaatcag
gcatcgggagtcagcgtgcggatgtcgatcgccaactatgaaaacctcgtctccaatgcg
gaaagacgagccattgtgcagcatgagaagctggctgtggcccggacttgcgatctcaat
tcgatggtgagcagttcccgcggcaagctcgaactttcgatgtcggatgaatcgggtgag
gaagataaactgctgggacgcattattgacgaggccaccaagaacatcttcgaccagcat
tttaatcccaagcagtttcgaaacgttgtcgaacatttcgatctgggagagtcgatcgag
ctaggcgatgggctgtcgtctgagcaaacttggcagaaattgagtgccattcgcggcttc
agcgagcaagtggaagctgctgccaaaaagctcgagccaacgctgctggagggtgccaca
agaacagcagtgctcgcgagcgtggccgaatttctgctggatggcctgtactgcagcaat
cgattgagccgccaaccccgcgggactgggctccattacggcaagtaa

DBGET integrated database retrieval system