KEGG   Planctomyces limnophilus: Plim_1195Help
Entry
Plim_1195         CDS       T01225                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
plm  Planctomyces limnophilus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:plm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:plm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1528476..1529960)
Genome map
AA seq 494 aa AA seqDB search
MDMLIIRGGIPLAGNVRLAGAKNASLPIMAASIAVSGLSQLRRVPHLADVSTLTQVLESL
GAVVTRDLSTGELAISPPHATTGIADYDLVRRMRASVCVLGPLLARWGKAVVSLPGGCNI
GHRPIDLHLKGLVALGARIRIERGYVHAEATRLHGAEIYLGGPFGSTVTGTANIMTAASL
ARGMTRISAAACEPEIVDLGNYLNAAGARITGHGTPVIEIEGVDELHGVEHEVIPDRIEA
GTMMIAAAATCGDVFIEDAQPRHLSAVIDILRQIGVSIEPSSTNDGRMGLHISGAAHLNP
ADCTALPYPGVPTDLQAQLTALLCLVPGISVITDKVFPDRFMHVPELLRMGAQIRREGAS
AIIAGPAHLSGTNVMASDLRASAALVIAALAAEGESVIRRVYHLDRGYEKHDEKLRQLGA
QIQRTTDHPEALPDSLRMTGESSMEQHKVQEIPGRFTQPIQNPLAKPHFLSDGYAIARPM
VSQSDDSSGPVADL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctgattattcggggaggcatcccactggccggcaatgtccgcctcgctggc
gccaagaacgcctctctcccgattatggctgcatcgattgcagtcagtggcttatcacaa
ttgcggcgtgtgcctcacctggcggatgtctcgacgctaacacaagtgctcgaatcatta
ggagcggtcgtcacccgagatctctcgactggcgaacttgccatttcccctccccacgca
accaccgggattgccgattacgatctggtcaggcgcatgcgagccagcgtctgcgtcctg
ggcccccttctggcacgctggggaaaagccgttgtttcacttcccggcgggtgcaatatt
ggtcacaggcccattgacctgcatctcaagggattggtggcactgggagctcggattcgt
attgaaagaggctacgttcacgccgaagcaacacggttgcatggcgcagagatttatctg
ggtggcccatttggcagcacggtcacggggacggcgaatatcatgacagccgccagcctg
gcacgagggatgacccgaatttctgcggcagcctgtgagccagaaatcgtcgatttggga
aactatctgaatgctgccggggcccgcatcaccgggcacggcacacccgtcatcgagatt
gaaggtgttgacgagttgcatggcgtggagcatgaagtcattcccgatcgcattgaagcc
ggcacaatgatgattgctgccgcagccacttgcggcgatgtgttcattgaagatgcccag
ccgcgtcacctttcggcagtgatcgatatcctgcgtcagattggagtctcaattgaaccc
tcatcaacgaatgatggccggatgggtctgcatatttcaggtgccgcccacttgaatccg
gctgattgcaccgcattaccttatccgggagtgcccaccgatcttcaggcacaactcacc
gctctgctttgcctggtcccggggatcagcgtgatcactgacaaggtcttccccgaccgg
tttatgcatgtgcctgaattgttacggatgggggcacaaattcgccgggaaggggcgagt
gccataattgccgggcccgcgcatttgagtggtacgaatgtgatggcttccgacttaaga
gccagtgctgccctcgtgattgctgctctcgctgcagagggcgaatccgtcattcgtcgt
gtgtatcatctggatcgtggctacgaaaagcatgatgaaaagctgcgacaactgggtgca
cagattcaaagaacaaccgaccatcccgaagcactgccggatagcctccgcatgacggga
gaatcaagtatggaacaacacaaggtccaggaaatcccgggccggttcactcaacccatc
cagaatccgttggcaaaaccacactttctcagcgacggttatgcgattgccaggcctatg
gtttcacaatccgatgattcttcaggaccagttgccgatctttaa

DBGET integrated database retrieval system