KEGG   Planctopirus limnophila: Plim_1376Help
Entry
Plim_1376         CDS       T01225                                 

Definition
(GenBank) peptidase M42 family protein
Organism
plm  Planctopirus limnophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1751709..1752773
Genome map
AA seq 354 aa AA seqDB search
MPLSELDRKFLDDLLAAPSPSGYEQPIQDVVRAYAAGFAETVTTDRHGNVMACVNPQGQV
RIMLAGHCDQIGLIVKNIDEKGFIWVQTIGGWDPMVLLGQRVQVWTRSGPIPGIMARKPI
HLQSPEDRKAVPEIKNLWVDIGALNGEEARAAVRVGDVITCELHQQTMRNGFVSGVAMDD
KVGVWTVFTAARRAALQSPKAAIYAVSTVQEEIGLRGVQTSAAAIRPQIGLVTDVTHATD
CPTIDENQHGRIKLGQGPVVYRGPNTNPRVFDLIEEEAAKHGIPYQLASLGTPASNDAAQ
LQLAGDGVAMGLICIPNRYMHSPVEMVSLEDLDHAANLMAAFCVRIQDDTNLIP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctctgaattggatcgcaagtttctcgatgatctcctggcggctcccagtccc
tcaggatatgagcaaccgattcaggatgttgtccgggcttatgcagccgggtttgcagag
actgtcaccacagatcgacatgggaatgtgatggcctgtgtgaatcctcaaggacaggtg
cgcatcatgctggctggccattgcgaccagattggcctgattgtcaaaaacatcgacgaa
aaagggtttatctgggtgcagacgattggtggttgggatcccatggtcctgctgggacag
cgcgtgcaggtttggacacgcagcggaccgattccagggattatggctcgcaagccgatt
catctgcagtcgccggaagatcgcaaagctgttcccgaaatcaagaatttgtgggtcgat
attggcgctctgaatggagaagaagccagggcggccgtgcgagttggcgatgtcattacc
tgtgaacttcatcagcaaaccatgcgaaacggctttgtcagcggtgtggccatggatgat
aaggtcggagtctggactgtatttacggcggcccgccgggcggcacttcaatcgccaaag
gcggcgatttatgcagtctccaccgtacaggaagaaattggtctgcgcggtgtgcagacg
agtgccgccgccatccgtccacagatcggtctggtgactgatgtgacccatgccaccgat
tgtccgacgattgatgagaatcagcatggtcgcatcaagctggggcagggtccggtcgtt
tatcgcgggccgaatactaatcctcgggtcttcgacctgattgaagaagaagctgcgaag
cacgggatcccttatcagctggcttcattaggcacaccagccagtaacgatgcggctcaa
ctccagttggcgggcgatggagtggccatgggattgatctgcattcccaatcgatacatg
cacagcccagtggaaatggtctcgctggaggatctggatcacgcggccaatctgatggcc
gcgttttgcgtgcggattcaggatgatacgaatctcatcccgtaa

DBGET integrated database retrieval system