KEGG   Planctomyces limnophilus: Plim_1410Help
Entry
Plim_1410         CDS       T01225                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
plm  Planctomyces limnophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Plim_1410
Enzymes [BR:plm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Plim_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801235..1802782
Genome map
AA seq 515 aa AA seqDB search
MDRASGVLLHPTSFPSRFGTGDLGHEAYQFVDWLAAAGQSYWQVLPLNPVDAGYSPYQSP
SSFAGNPLLISLEKLVDDELLTREELDQAAIAGADGSGSASFELAFERKMPLLHRAAERF
HQLHEDHELRVAFRTFCSAQAGWLDQMALFEALKGANAGRPWTTWTHLVDHWHYPGPEAI
TVLQEPIFVAKFQQFMFFRQWNELRAYARNRGILIIGDVPIYVAHDSADVWSNRRFFQLN
EAGQALQVAGVPPDYFSATGQLWNNPVYDWRALEEDEYRWWARRLQAVMEAVDLVRLDHF
RGFEAYWSVPAGHETAEQGTWVPGPGHRLFNALKSQLRIPEGMTRLPIIAEDLGTITAEV
DELRLAYGLPGMKVLQFMIAENDPFQPQEFPPESICYTGTHDNDTTVGWFQSHVAPFADR
FDRLRQRIEFSSEDIAWDLIAVAWKSRSNIAIAPLQDLLSLPAAARMNTPGTFGASARNW
IWQYEPGVLTKDLADRLHRLTMANHRFLGDRPPQF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgcgagtggtgtgctgctgcatccgacatcatttcccagtcgttttggtacg
ggagatctcggtcatgaggcctatcagtttgtcgattggctggctgctgccggccaatcg
tactggcaggtcctcccactgaatcctgtcgatgccggttattctccttatcaaagtccc
tcttcgtttgctggcaatccgctgctcatcagcctggaaaagctggttgacgacgaactt
ctcacgcgagaggaactcgatcaggcagcgattgccggcgccgatgggagtggcagtgcc
agctttgaactggccttcgagcggaaaatgccattgctgcaccgcgctgcggaacggttt
catcagcttcatgaagaccacgaacttcgagtggcatttcgaacattctgcagtgcgcaa
gcaggctggctcgatcagatggccttgtttgaagccctgaaaggtgccaatgcaggccgc
ccctggacgacctggacacatctcgtcgatcattggcattaccctgggcccgaagccatc
acggttcttcaagagcccatcttcgtggccaagttccagcagttcatgttcttcaggcag
tggaacgaattgcgtgcctatgcccgaaatagaggcattctcatcattggcgatgtccca
atttatgtcgctcacgacagtgccgacgtctggtcgaatcgtcgcttctttcaactcaac
gaagccgggcaggctctgcaggtcgcgggcgtacctccggactacttctcggccactggt
caactctggaacaacccggtctacgattggcgagcacttgaagaagacgagtaccgctgg
tgggccaggcgattacaagccgttatggaagcggtcgatctggtacggctggatcatttc
cgagggtttgaagcctattggtcagttcccgcaggccatgagacggccgagcagggtaca
tgggtccccgggccggggcatcgcctgtttaatgctctcaagtcgcaactgcgaataccc
gaagggatgacacgcctcccgattattgcggaagatctcggcaccattactgctgaggtt
gatgaactgcgccttgcctatggtttaccagggatgaaggtgctccagttcatgattgcc
gagaacgatcctttccagcctcaagaatttcctcccgaatcgatttgctacacagggact
cacgataacgacaccacggtcggttggttccagtcacacgtggcgccctttgccgatcgc
ttcgatcgcctgcgtcaacgaatcgaattctcgagtgaagacattgcgtgggatctgatt
gccgtggcctggaagagccggtcgaatatcgcaattgcaccccttcaagatctcctttct
ctcccggctgcggcccgcatgaatactccaggaacttttggcgcttcagctcgtaactgg
atctggcaatacgaacccggtgtgcttacaaaagaccttgctgatcgtttgcatcgactg
actatggccaatcatcgtttccttggagatcgcccgccacaattctag

DBGET integrated database retrieval system