KEGG   Planctomyces limnophilus: Plim_1555Help
Entry
Plim_1555         CDS       T01225                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
plm  Planctomyces limnophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plim_1555
Enzymes [BR:plm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Plim_1555
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Plim_1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2002458..2004095
Genome map
AA seq 545 aa AA seqDB search
MTNRIGKVYLVGAGPGDAGLLTIRGWQCLQEAHLVLYDGLVNPRILNWSRGEAVRSCRAG
RSAGGDRAISTHPGWISQSEINSRMIEAARNGQIVVRLKGGDPFIFGRGGEEAAALAEAG
IPFEVVPGITAATAAAVYSGLSLTHRECASAVAFITGHEDPDKTEQTLNYQSLANFPGTL
VFYMGLHRLETIARALIEAGKPAETPAMVVSQATTSRQQMVEATLADIAAKAKQANLLAP
SLAMIGNAIEWRTPAAWFEERPLRHLRIAIPRPLEQGELTALECEQLGGSPLLMPTISIS
SIDDWTLVDGIIDRIAEFDWIIFTSVNGVRCFMQHLWQRGLDGRELAGCRLAVIGASTAA
ELEKWHLRADFVPSQFRGEVLAEELAQQFSAGRAIWFRANRGREVIPERLQKAGWSMETA
VVYRNEDVTSWPADFWEKLSRKEVDWIALSSPSMARNWKKLLDAYLRESGRNASEFINAA
RFVSISPVTTQAALEAGLSISAEASVFTWEGIFRAIANAEGRPWLNVSTSAAMPTKSSFP
PGEES
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcggattggaaaagtttatctggtcggtgccgggccgggtgatgcgggattg
ttaaccattcgtggctggcaatgtctacaggaggcccatctggtgttgtatgacggcctc
gtcaatccacggattctgaattggtcgcgtggtgaggctgttcgaagctgtcgcgcaggt
cgttcggccggtggagatcgcgccatcagcacacatccgggctggatttctcaatcggag
atcaactcccggatgattgaagcggcacgcaatggccagatcgtggtgcgattaaaggga
ggcgatccttttatctttgggcgcggcggtgaagaagctgctgctctggctgaagcgggg
attccgtttgaagtggttccggggattacagccgccactgctgcagccgtctattcgggt
ttatcactgacgcatcgtgagtgtgcctcggcagtggcattcattacggggcacgaggat
ccagataaaactgaacagacattgaattatcagtctctggcgaactttcctggcacgctc
gtcttctacatgggtttgcatcgcctggagactatcgccagagcacttattgaagccggc
aagccggcagagacaccggccatggttgtgagtcaggcgaccacatctcgtcagcaaatg
gtggaagcgactctggcggatattgctgccaaggccaaacaggccaatctcctggcgcca
tcactcgccatgattggaaatgcgattgagtggcgcacccctgctgcctggtttgaagag
cggccacttcgccatctgagaattgcgattcccagaccactcgaacagggagaattaacg
gccctcgaatgtgagcaattgggaggttctccgctgctgatgcccaccatctcgatctcg
tccatcgatgattggactctagtcgatggaatcatcgaccgtatcgcagagttcgactgg
atcattttcaccagtgtcaatggtgtgcgttgtttcatgcagcatttgtggcaacgcggg
ctggatggtcgcgagctggcgggttgccgactggctgtgattggtgcgagcactgctgct
gaactggagaagtggcatcttcgtgccgactttgtgccctctcagtttcgcggtgaagtc
cttgcggaagaactcgcacagcaattctctgcaggacgtgcgatctggtttcgggcgaat
cgtggacgagaagttattcctgagcgacttcaaaaagcgggctggtcaatggaaacggct
gtggtgtatcgcaacgaggatgtgaccagttggccggcagatttctgggaaaaactctct
cgtaaagaagtggattggattgccttgagcagcccgtcgatggccagaaattggaaaaaa
ctacttgatgcttatctgagagaatctggccgcaatgcgtcagagttcatcaatgcggct
cgatttgtaagcatcagtccggtgacgacacaagccgccctcgaagcggggttatcgatt
tctgcggaagccagtgtattcacctgggaaggcatttttcgggccattgcgaatgccgaa
ggcaggccatggctgaatgtttccaccagcgcggccatgcccacaaagagcagtttcccg
cctggtgaggaaagttag

DBGET integrated database retrieval system