KEGG   Planctomyces limnophilus: Plim_1695Help
Entry
Plim_1695         CDS       T01225                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
plm  Planctomyces limnophilus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plm00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:plm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199725..2201329)
Genome map
AA seq 534 aa AA seqDB search
MPIDNPPQSLSREIRQGQIPLKWSRRQIMAAGFGAVLWPTLSTWTEGAVLNRNYRLGPNP
FGLGVAAGDPQPTGAVLWTRILPDPLSDEPVEPVAIPVQWEVSHDEKFSKIMQKGTAVAT
PDMAHAVHVEVSGLDPDRWYFYRFLASGGASRTGRFRTMPRPEALNNRLRMAFASCQHFE
QGLFTAYDHMSKEDLDLIFHLGDYIYEYKGKDRLVRKHRGNEIESIEDYRQRHAQYKSDE
FLQAAHALCPWIVTWDDHEFDNNCAGYISEQKDVDPAKFLDRRANSYRAYYEHMPLPRAC
LPEGPHMALYRPATFGRLADFSVLDTRQYRSDQPCGDGNKPPCPESLSPSQTMLGPAQEK
WLAQRLKASSSIWNVLAQQVMMGHVDRKAGEEVAYSMDQWPGYEVERQRILGFFDREKIS
NPIVLTGDIHSNWVNNLAPGQDDNAQPVATEFVVTSISSSGNGSQNLKYAQTVQDENPFV
KFYNAERGYVSCEITPKSWTSNYQVVEYVDKPGAPLVTRASFAVESGKAGAQKM
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgccaatcgataaccccccgcagtccttatcgcgagaaattcgtcaaggtcagatcccg
ttgaagtggtctcggcgacagatcatggctgctggatttggtgcagttctgtggccgaca
ttatcgacatggacagagggggctgttctcaatcgtaactatcggctggggccgaatcct
tttggattgggtgtggctgcgggtgatcctcaaccgactggtgctgtgctctggacacgt
attcttcccgatccgctgagtgatgagcctgtcgaacctgtggcgattcccgtccaatgg
gaggtctctcacgacgagaagttctcgaagatcatgcagaagggaactgcggtcgctact
cccgatatggcgcatgcggtgcatgtcgaagtgagcgggttagaccctgatcgatggtac
ttctatcgatttcttgcctcaggtggtgccagtcgcacgggccgttttcgaaccatgccc
aggcctgaggctctcaacaaccggttgcgaatggcatttgcttcgtgccagcactttgag
cagggccttttcactgcgtatgaccacatgtccaaagaggatctcgatctgatctttcat
ctgggggattacatttatgagtacaaggggaaagatcgcctggtgcgaaagcatcgaggt
aatgagatcgaatcgatcgaagactatcgacagcggcatgcgcagtacaaaagcgatgaa
tttcttcaggcagctcacgcactttgcccatggattgtgacctgggatgatcatgaattc
gataacaattgcgcgggatacatttccgagcagaaagatgtcgatcctgccaagtttctc
gaccggagagcgaacagctatcgggcttattacgagcatatgccattgcctcgcgcctgc
ctgcctgaggggccgcatatggcgctctatcgtccagccacatttggccgattggccgat
ttttctgtgctggatacgaggcagtaccgttcggatcaaccctgtggggatggaaacaaa
cctccctgcccggaatcgctctcgccttcgcaaaccatgctggggcctgctcaggagaag
tggctggcccagcggctcaaggcctcgtcgtccatctggaatgtgctggctcagcaggtc
atgatggggcatgttgatcgcaaagccggggaagaggtggcttatagcatggatcaatgg
ccaggttatgaagtcgagcgacagagaattcttggtttctttgatcgcgagaagatttcc
aatcctattgttctgacaggtgatattcacagcaactgggttaacaacctggcgccaggt
caggatgataacgcccagcctgtagccactgagtttgtcgtgacatcgatcagttctagt
gggaatggatcacagaatctgaaatatgcccaaactgtgcaggatgagaatcccttcgtg
aagttctacaatgccgagcgcgggtatgtcagttgtgagatcactcctaagagctggacg
tcgaactatcaggtcgttgagtatgtcgacaagcccggtgcaccactggtgacgcgtgcg
agctttgccgtggagagcggtaaagctggtgcccagaagatgtag

DBGET integrated database retrieval system