KEGG   Planctomyces limnophilus: Plim_1911Help
Entry
Plim_1911         CDS       T01225                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
plm  Planctomyces limnophilus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:plm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plim_1911
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Plim_1911
Enzymes [BR:plm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Plim_1911
Two-component system [BR:plm02022]
 CheA family
  CheA-CheYBV
   Plim_1911
Bacterial motility proteins [BR:plm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Plim_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2492923..2494080
Genome map
AA seq 385 aa AA seqDB search
MSLRPVKILVVDDSAVIRGLMAKVIESTEGLQLAGTAMHGEAALAFLKRNPVDIVVLDVE
MPVMNGLDALRQIQIQFPGTHVIMASALTTAGAKVTVEALAQGAAGCVAKPQAKSASDAI
QQVGAELVPLIRALTNKPEANTPDAAIVAEAEIRPHAESNVTRTNNARYASSTTETAIRS
TGTSVLRRMPRPVQAIVIGTSTGGPKALSQIMSSIDDTIWQPILIVQHMPAAFTPMLAKH
LGSDSRRVCVEAQTGMPILPGHIYVAPGDYHLEVVRKGGDIVAQLHQAAPEHYCRPSVNP
LFRTAAEVWGKHLAAVMLTGMGDDGIEGTQAVHQAGGYILAQDAVSSVVWGMPGAVVKAG
LHDEMLSLSEIAGRLRQIALWKGAA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacgtccagtgaaaattctggtcgtggatgactccgccgtgatccgtggcctg
atggctaaagtcattgaatcgaccgagggattgcagcttgctggaacagcgatgcatggc
gaagccgccctggcatttctgaaacgcaatcctgtggacatcgtggtcctcgatgtcgag
atgcctgtgatgaatggactcgatgccttgcgtcagatccagattcaattccccggtaca
catgtcatcatggccagtgctctcacgacggccggggcgaaagtgacggttgaagcattg
gcgcaaggcgctgcaggttgtgttgctaaacctcaggcaaagtcggcatctgatgcgatc
cagcaggtcggggccgaactcgtaccgctcatccgggccttaacgaacaaacctgaggca
aacactccggatgcggcgatcgttgcagaggccgagattcgtccacacgctgaatccaac
gtgacccgtaccaataatgcaagatatgcatcgtcgacaaccgagacggccattcgatca
actggcacttcggtcttacgcagaatgcctcggcccgtgcaggccattgtgattggcacc
agcacaggtggccccaaagctctgagccagatcatgtcgagcattgatgacacgatctgg
caaccgatactgattgttcagcacatgccggcagcatttacaccaatgctggcgaagcat
ctgggaagtgattcccgcagagtttgtgtcgaagctcagacgggcatgccaattctcccc
gggcacatctatgtggctcccggagattatcatctggaagttgttcgtaaagggggggat
atcgttgcccaacttcaccaggcagcaccagaacattattgccgtccatcggtgaatccg
ctctttcggacagcagcagaggtctggggcaagcatctggcagcagtcatgctgaccggt
atgggtgatgatggaattgaagggacacaggccgtccatcaggcgggtggttacatattg
gcacaggatgctgtctcaagcgtggtttggggaatgccaggagccgtcgtgaaagcaggc
cttcacgatgagatgctctcgctgtccgagattgcaggtcgtctccgacagattgcattg
tggaaaggggcagcatga

DBGET integrated database retrieval system