KEGG   Planctomyces limnophilus: Plim_2049Help
Entry
Plim_2049         CDS       T01225                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
plm  Planctomyces limnophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_2049
   01230 Biosynthesis of amino acids
    Plim_2049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_2049
   00051 Fructose and mannose metabolism
    Plim_2049
   00562 Inositol phosphate metabolism
    Plim_2049
Enzymes [BR:plm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Plim_2049
Exosome [BR:plm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Plim_2049
  Exosomal proteins of bladder cancer cells
   Plim_2049
  Exosomal proteins of melanoma cells
   Plim_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2662434..2663207
Genome map
AA seq 257 aa AA seqDB search
MRRLFVAGNWKMNTNLASGKELAKGVAAEAQRLGDAIDIAVCPPFVYLSNVKAELAGSKV
QLGAQNTWFAAPGAFTGETAVEMLKDIGCSWVILGHSERRQLLGEKDELINKKIAAATSE
DLGVIFCVGELLEDRQAGRTETVLETQLSGGLANLDAAVLGQIVIAYEPVWAIGTGVTAT
PEQAEGAHAFIRGWLTKQYGAKVADSVRILYGGSVKADNAEALMSLPNVDGALVGGASLT
TAQFAPILQAAALVASR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcctgtttgtggctggcaactggaaaatgaataccaaccttgccagtggcaaa
gaacttgccaaaggtgtggctgccgaagctcagcgtctgggtgatgcgatcgacattgcc
gtttgcccaccgtttgtctatttgagcaacgttaaagccgagctggcaggttcgaaagtg
cagcttggtgcccaaaatacatggtttgcagctcccggtgcctttacgggagaaaccgct
gttgaaatgctcaaagatattggctgctcctgggtgattctcggccacagtgaaaggcgt
cagctgctcggcgagaaggacgaactgatcaacaaaaagatcgcagctgcgacttccgaa
gatttaggcgtcattttctgtgtgggcgaactgctcgaagatcgtcaggcagggcggact
gaaaccgttctggaaacccagctttcaggcggactggcaaatctggatgcagccgttctt
ggtcagatcgttattgcgtatgaacctgtctgggccattggcactggagtgacagccact
ccggaacaggctgagggcgcccacgccttcattcgcggctggttaacgaagcagtacggt
gccaaagtggctgacagcgtgcgaattctttacggcggtagtgtcaaggctgacaatgcc
gaggccttgatgtctttgccgaacgtcgatggggctctggtcggaggagccagtctgaca
actgctcagtttgctcccatcctgcaggctgcggccctagtggcctcgcgctga

DBGET integrated database retrieval system