KEGG   Planctomyces limnophilus: Plim_2268Help
Entry
Plim_2268         CDS       T01225                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
plm  Planctomyces limnophilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:plm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:plm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2929763..2930710
Genome map
AA seq 315 aa AA seqDB search
MKATWSRRHVLGLEDLSAAEITTILDEAARFKEMARHGEARHSLLKGVTICNLFFEPSTR
TKTSFNLAARRLGADTVDFTAAASSLSKGETFIDTARNIEAMGVDHMVVRHSTSGTPFLL
TKHLGTGVVNAGDGTHEHPTQGLLDLFTIREQRGRIEGLTVALVGDILHSRVARSNIWGL
KKLGAKVIVCGPATLIPAEIRQLGVEVSYRLDEILEQTDVINLLRIQFERQRGAFFPSIY
EYAQFYGMTSERIARAKSDVLILAPGPINRGVELTPDVADGPHSVILDQVTNGLFVRMAT
LYLMQLAREQALTST
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacttggtcgcggcgtcatgtgctggggctggaagatctttccgcagccgag
attaccaccattctcgatgaagcggcccgttttaaagagatggcccgtcatggagaagca
cggcattccctgctgaaaggagtgacgatctgtaacctcttttttgagccatccacacgc
acgaaaacaagtttcaacctggcagcgcgtcggctcggtgccgataccgtagactttacc
gcagcagcgagcagtctctcgaagggcgaaaccttcattgacacggctcgaaacatcgag
gccatgggtgttgaccacatggtggttcgccacagcacttcaggcacaccatttttgctg
accaaacatcttggtactggtgtggtcaatgccggtgatggcactcacgaacacccgaca
caaggtctgctggatctattcacaattcgtgaacagcggggccgtatcgaaggtttaacg
gtcgcactggtgggagatatcctgcacagtcgagtggcccgatcgaacatctgggggctg
aaaaaactcggtgctaaagtcatcgtttgcggcccagccaccttgatcccggctgaaatt
cggcaactcggagtcgaagtaagttatcggctcgatgagattctggaacagacggacgta
atcaatctgttacgaattcaattcgaaagacagcgtggcgcgttttttccttcgatttat
gaatatgcccagttctatgggatgacatctgagcgaattgcccgcgcgaagagtgatgtt
ctcatactcgcacctggccccatcaaccgtggcgtcgaactgacgcctgatgtagccgat
ggcccgcacagcgtgattctcgatcaggtgacaaatggtctgtttgtgcgcatggccact
ttgtatctgatgcaacttgcgagagaacaagccctgacttctacataa

DBGET integrated database retrieval system