KEGG   Planctopirus limnophila: Plim_2286Help
Entry
Plim_2286         CDS       T01225                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
plm  Planctopirus limnophila
Pathway
plm00860  Porphyrin and chlorophyll metabolism
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plim_2286
Enzymes [BR:plm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Plim_2286
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Plim_2286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Prenylcys_lyase Pyr_redox_2 MCRA Pyr_redox FAD_binding_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ADG68112
UniProt: D5SNJ8
Position
complement(2950673..2952202)
Genome map
AA seq 509 aa AA seqDB search
MNAPGGSDQGGYKSDSPRRSSSPFRIAIVGGGLSGLAAAHRLVEIAAEQNRRFEITLFES
QSRLGGLVGTESIAGYQIDLGGDSFITDKPAALNLCLRLGLKDSLIGMSKNFRGAYILRG
KKLCLVPEGVNLMTPSKALPILTTSLLSVSGKLRMLGERFVPPRQDENDESLEAFVVRRF
GREAFDRLVQPLVSGIYTADPSKLSIQAALPRFPADEKQYGSLIRAATVRALQKRGSPQQ
QATGARYGLFLGLKGGMQELVDWLLARIVGQISLRLSTEVTRVEHQSQNENAAHQSEVVL
HTKGRRPETFDTVILALPAWKSAELLATDQASLSQELSRIEFASSVIVVTGHQESQIKKP
LGAFGLVIPRVERRKILAVSFSHRKFPDRVPPGCALLRTFVGGALQPELCELDDQQLQKL
VHQELQEMLGVEGEPVVSRIVRYPRAMPQFHLGHRELVARIREQLAQTPRIVLAGNSYDG
VGIPDTIASGEQAAERIAGFDTKTESPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcctggaggatctgatcagggcgggtacaaaagtgattctcccagaagatct
tcttcacccttccgaattgccattgtcggtggtggcttgagtggactggctgctgcacat
cgcctggtcgaaattgctgccgagcagaaccgacgatttgagatcacgttgtttgaatcg
caatctcggctgggtgggctcgttgggactgaatcaattgccgggtatcagattgatctg
gggggcgattccttcatcactgataaaccagcagcattgaatctttgccttcgcctcggg
ctgaaagattctctgattggtatgagtaaaaactttcgaggggcctacattcttcgtggc
aagaagttatgcctcgtgccagaaggggtcaacctgatgactccttccaaggctttgccc
atcctgacgacatccctgttatcagtctcaggcaaactgcgcatgctcggtgagcgtttt
gttccacccaggcaagacgagaacgatgagtcgctggaagcgttcgttgtgcgaaggttc
ggccgggaagcatttgaccgactggtacaaccgttggtaagcggtatttatacggccgac
ccgtccaagctgagtattcaagcggcacttcctcgttttccggcggatgaaaaacaatac
ggcagtctgattcgtgcagcgacagttcgtgctttgcagaagcgaggctctccccaacag
caggccacaggagcccgctatggattgtttctgggattaaaaggtggcatgcaggaactg
gtggactggttacttgcaagaatcgtcggccaaatttccttaagactgagtaccgaagtc
actcgagtcgaacatcaatcccaaaacgaaaatgctgctcatcaaagtgaggtcgtactg
catacaaagggtcgacgaccagaaacttttgacacagtgatcctggcacttcctgcgtgg
aaatcggcggaacttctggccacggatcaggcgagtctttcccaggagctctcccgaatt
gaattcgcttcgagtgtcatcgttgttacggggcatcaggaatcgcagatcaaaaaaccg
ctgggagctttcggtttagtgattccacgggtcgagcgtcgcaaaattctggcggtctca
ttttcgcatcggaagttccccgatcgagtccctccgggttgtgcattgttgcgaacgttt
gtcggcggagcgctacagccagagttgtgcgaactggacgatcaacagttgcagaaactc
gtgcatcaggagttgcaggagatgttaggagttgaaggagaacccgtggtttcgcgtatt
gtgcgatatcctcgggcgatgccgcaatttcatctgggccaccgggaactcgtcgccagg
attcgcgaacagcttgcacagacacctcgaatcgtgctggcgggcaactcctacgatgga
gtgggaattcccgataccatcgccagtggcgaacaggcggccgaacgcattgccggcttc
gacacaaaaacagaaagcccccagccataa

DBGET integrated database retrieval system