KEGG   Planctomyces limnophilus: Plim_2288Help
Entry
Plim_2288         CDS       T01225                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
plm  Planctomyces limnophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plim_2288
Enzymes [BR:plm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Plim_2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2953445..2954320)
Genome map
AA seq 291 aa AA seqDB search
MLGKANVQSSSHPVSNDKTDRLKICSFESRRGEEMASLIERMGGLATIAPSMREISLGEN
PEAFRFGERLLNHEFRLMVFLTGVGARALLEVLETRFPRDEILAAWDRCVTIVRGPKPHA
VLREWGVHVDARAPEPNTWRELLSTLDDWGALQSVSMAVQEYGQPNELLYEELQQRGAIV
TRVPVYRWALPEDLNPLENAIRTCVRGEFDALLWTSAQQVHHVLEVADRMGLKIQFLQAA
NRCVIGSIGPTATETLIEQGLAPDLEPEHPKMGPLVKLVCEAGLPIVARKQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaaaggcgaacgtgcagagctcatctcatccagtcagtaatgataagactgac
cgcctgaaaatctgctctttcgagagccgccgtggcgaggagatggcttcgctgatcgag
cgtatgggcgggctcgccacgattgcaccgtcgatgcgtgagatttctctcggagagaac
cctgaggcgttccgatttggggaacgattactcaatcacgaattccgcctgatggttttc
ctcaccggtgtgggggcgagagctttacttgaagtattggaaactcgatttcccagagac
gagatcctggctgcctgggatcgctgcgtgacgattgttcgtgggcccaaaccccatgcc
gtgctgagggagtggggtgtgcatgttgatgcgcgtgcccccgaaccaaacacctggcga
gaactgctttccactctcgacgattggggtgcacttcaatccgtttcgatggctgtgcag
gaatatggtcagcccaatgagttattgtacgaggaacttcagcagcgtggtgccattgtg
acgagggttcccgtctatcgatgggctttgccagaagatttaaatccccttgaaaatgcg
attcgtacctgtgtgcgaggtgagtttgatgctctcttgtggacgagtgctcagcaggtg
catcatgtgctggaagtcgccgatcgcatggggttgaaaatacagtttcttcaggcagcc
aaccggtgtgtgattggttcgattggccccactgcgacagaaacgcttatcgagcagggg
cttgctcctgacttagaacccgagcatcctaaaatgggcccactggtcaagctggtttgt
gaggccggtttgccgattgttgcccgaaaacagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system