KEGG   Planctomyces limnophilus: Plim_2334Help
Entry
Plim_2334         CDS       T01225                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
plm  Planctomyces limnophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Plim_2334
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Plim_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3025935..3026879
Genome map
AA seq 314 aa AA seqDB search
MSASESSVVNQVEIVGTGLVVADYRMIVPDYPQEDTKISGQALPRQVGGPVPTGLTMLRR
LGHSCRMIGSWGEDDAGAFISQQLTSEGIDLQYALVGAERETGLAHIWINEQTGRRTVVS
HRPRQHLEPADFQRPMFVGAKCLYLDGWPVNSSIAAAKLARECGLRVFLDAGSYRPGLED
LLPYVDVLNASRRMIQEFLRTDSLEDAAARLQALGPRWVITTFGEAGAVLHTRSHVVEQE
AFHVVTRDTNGAGDVFCGSFVHGWLENWPADYTLRFACAAGAIKCSHHGNRDALPTLGAI
FRMAGPIPLDEDEH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatcggaaagcagcgtggtcaatcaggtcgaaatcgtaggaacaggcctcgtt
gtggccgactaccgcatgattgtccctgactatcctcaggaagatacgaaaatctcgggg
caggctttaccccgtcaggtgggcgggcctgttcccacaggccttacgatgctcaggcgc
ctggggcattcctgccgcatgattggtagttggggtgaagatgatgccggcgcattcatt
tcccagcagctgacatcggaagggatcgatctacagtacgctctggtgggagcagaacgc
gagacgggtttagcccacatctggatcaatgagcagactggccgacggacagtggtcagt
caccgccccaggcaacatctcgaaccagcagactttcagcgtccaatgtttgtaggagcc
aagtgtctgtatctcgacggctggcctgtgaattcctcgattgctgccgccaaacttgcc
agagaatgtggattacgagtctttctggatgcgggaagttatcgccctgggctggaggat
ctgctgccctatgttgatgtgcttaatgcttcccgacgaatgatccaggagtttttgcga
acggattcgctggaagatgccgctgcgcgattacaggctctggggccacgctgggtcatc
accacctttggggaagcgggggcggtcttacatacccgcagccatgttgtcgagcaggaa
gcgttccacgttgtgacgcgggataccaatggtgcgggggatgtcttctgtggcagcttt
gtgcatggctggcttgaaaactggcctgccgactacacacttcgttttgcctgcgctgct
ggagcgatcaaatgcagccaccacggaaatcgcgatgccctccccactctgggagcgatt
tttcgcatggccgggcccatccctctcgatgaagacgaacattga

  All links  
No link information was found.   
DBGET integrated database retrieval system