KEGG   Planctopirus limnophila: Plim_2404Help
Entry
Plim_2404         CDS       T01225                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
plm  Planctopirus limnophila
Pathway
plm00010  Glycolysis / Gluconeogenesis
plm00052  Galactose metabolism
plm00500  Starch and sucrose metabolism
plm00520  Amino sugar and nucleotide sugar metabolism
plm00521  Streptomycin biosynthesis
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01120  Microbial metabolism in diverse environments
plm01130  Biosynthesis of antibiotics
plm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_2404
   00052 Galactose metabolism
    Plim_2404
   00500 Starch and sucrose metabolism
    Plim_2404
   00520 Amino sugar and nucleotide sugar metabolism
    Plim_2404
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Plim_2404
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Plim_2404
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Plim_2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADG68230
UniProt: D5SP86
Position
complement(3134712..3135713)
Genome map
AA seq 333 aa AA seqDB search
MIAASHDDGYWLGFDLGGTKMHAGLFDRKLQPVGHRRKKTRGHEGAEAGVERICNSIEKL
LVELDVSVSQLRGIAVGCPGPLDLDKGIIVESPNLGWKNVPLKDILEKRFGCEATILNDV
DAGVYGEHRFGAGSGARTTLGVFPGTGIGAGLVYEGRIYRGRKSSCLELGHIPVVPNGAM
CGCGRRGCLETVASRLAMSAEIAKAAYRGQAPHLMRVAGTDLANIRSGTLAEAISDGDTV
VEKIVRDGAHHLGVAIAGTVNLLLPDVIVLGGGLVEALPKLFLEEVQNALGSHIMPAYEG
AVEVKVAKLGDDAGALGAAAWIRHLVEEKTAKN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcctcgcatgatgatggatactggctggggtttgatttaggcggcacaaaa
atgcatgccggtctgtttgaccgcaagctgcaacctgtgggccaccggagaaagaaaacc
cgcgggcatgaaggtgccgaagcgggtgtggagcgaatttgcaacagcattgaaaagctg
cttgtggaactggatgtctcagtttctcaattgcgcgggatcgcagtaggctgcccgggg
ccgttggatctcgacaagggaatcattgtcgagtctccgaatctgggttggaagaatgtg
ccactgaaggacattctggaaaagcgatttggttgcgaggccaccattctcaatgatgtt
gacgccggtgtgtatggcgagcatcgctttggagcaggttccggtgcccgcacgactttg
ggagtttttcctgggacagggatcggtgcaggtctcgtctatgagggtcgaatttaccgc
ggtcgcaagtcgtcttgtctggaattggggcacattccggtggtgcccaatggggccatg
tgcggttgtggccgccgaggatgcctggaaacggtcgcgagtcgactggcgatgtcggca
gagattgccaaggcggcctatcgagggcaggccccccatctgatgagggttgcaggaacg
gacctggcgaacattcgcagtggaacattggccgaggccatcagcgatggtgatacagtg
gtggagaagattgttcgcgatggcgcccaccatctgggcgtagcgattgcaggaactgtc
aacctgctgcttcccgatgtgattgtattgggcggggggttggtggaggcattgcccaag
ctcttcctggaagaagttcaaaatgcattgggatctcatatcatgcccgcctacgaaggg
gctgtcgaagttaaagttgccaagctgggagatgatgccggtgcactgggtgctgccgcc
tggattcgtcatctcgtcgaagagaaaactgccaagaattga

DBGET integrated database retrieval system