KEGG   Planctopirus limnophilus: Plim_2406Help
Entry
Plim_2406         CDS       T01225                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
plm  Planctopirus limnophilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_2406
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plim_2406
   00640 Propanoate metabolism
    Plim_2406
   00660 C5-Branched dibasic acid metabolism
    Plim_2406
Enzymes [BR:plm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plim_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3136961..3138145)
Genome map
AA seq 394 aa AA seqDB search
MKIHEFQAKELLAKAGVAVPRGIVAKTPEEAQAAYGQLGTAVAVVKSQIHAGGRGKGRFK
EQPEQPGVVLVKSAEDAAANASRMLGNTLVTIQTGEEGKKVQTLLVEQGLKIAREIYAAC
VVDREVAGPVIIVSSEGGMDIEEVAAHHPEKILTEAFDPVYGLEGYQARKLAFALGLEGN
ALKNAEKFFRQLSKFFLDNDCSMAEINPLVVTEEGELLALDAKVTFDDNALFRHQNVLAY
RDLAEEEPSEIEAQKWGLSYVKLDGNLGCLVNGAGLAMSTMDLIKLHGGEPANFLDVGGG
ANVDQVTEAFRIILADKNVKGILVNIFGGIMKCDTIVTALLTAYDKIGIQVPLVVRLEGT
NVELARKMLAESGKKITAGLDLTDAAKKAVASIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtttcaggcaaaagaacttctggccaaagccggagtggctgtacca
cgcggaattgtcgccaagacacctgaagaggctcaggccgcttacggtcaactgggaaca
gcagtcgctgtcgttaaatcgcagattcatgcgggtggtcgagggaagggtcggtttaaa
gagcagcccgagcagcccggggtggtgctggtgaagtcggctgaggatgcagctgccaat
gccagtcgcatgctgggcaataccctcgtgacgatccagacgggtgaagagggtaagaaa
gttcagacgctgctggtcgagcagggtctgaagattgcacgcgagatctacgccgcctgt
gtggttgatcgcgaagtggccggccctgtcatcattgtctcttcggaagggggcatggat
atcgaagaggtggcggcccatcatccggagaagattctcaccgaagcgtttgatcccgtc
tatggtctggaaggctatcaggcccgcaagctggcttttgctctggggctggaagggaat
gctctcaagaatgccgaaaagttcttccggcagctttcgaagttcttcctcgataacgat
tgcagcatggcggaaatcaatccgctggtcgtgacggaagaaggtgaactgctggctctc
gatgccaaggtgacgtttgacgacaacgcacttttccgccatcagaacgtgctggcttat
cgagatctggccgaagaagagccttcggaaatcgaagctcagaagtggggactgagctac
gtcaagcttgacggcaatcttggttgcctcgtgaatggtgccgggctggcgatgtcgacc
atggatttgatcaagctgcacggcggtgagccagccaacttcctcgatgtgggtggtggt
gccaatgtggatcaggtgacggaagccttccgcattatcctcgctgataagaacgtcaaa
gggattctggtcaatatcttcggtggcattatgaagtgcgacacgattgtgacagcactt
ttgacggcctacgacaagattggcattcaggtgccgctggtggttcggctcgaaggaacc
aatgtggaactggcccgcaagatgttggcggaaagtggcaagaagatcacggcaggtctg
gatctgactgacgctgccaaaaaggccgtcgcttcgattgcgtaa

DBGET integrated database retrieval system