KEGG   Planctopirus limnophila: Plim_2406Help
Entry
Plim_2406         CDS       T01225                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
plm  Planctopirus limnophila
Pathway
plm00020  Citrate cycle (TCA cycle)
plm00640  Propanoate metabolism
plm00660  C5-Branched dibasic acid metabolism
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01120  Microbial metabolism in diverse environments
plm01130  Biosynthesis of antibiotics
plm01200  Carbon metabolism
Module
plm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plim_2406
   00640 Propanoate metabolism
    Plim_2406
   00660 C5-Branched dibasic acid metabolism
    Plim_2406
Enzymes [BR:plm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plim_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: ADG68232
UniProt: D5SP88
Position
complement(3136961..3138145)
Genome map
AA seq 394 aa AA seqDB search
MKIHEFQAKELLAKAGVAVPRGIVAKTPEEAQAAYGQLGTAVAVVKSQIHAGGRGKGRFK
EQPEQPGVVLVKSAEDAAANASRMLGNTLVTIQTGEEGKKVQTLLVEQGLKIAREIYAAC
VVDREVAGPVIIVSSEGGMDIEEVAAHHPEKILTEAFDPVYGLEGYQARKLAFALGLEGN
ALKNAEKFFRQLSKFFLDNDCSMAEINPLVVTEEGELLALDAKVTFDDNALFRHQNVLAY
RDLAEEEPSEIEAQKWGLSYVKLDGNLGCLVNGAGLAMSTMDLIKLHGGEPANFLDVGGG
ANVDQVTEAFRIILADKNVKGILVNIFGGIMKCDTIVTALLTAYDKIGIQVPLVVRLEGT
NVELARKMLAESGKKITAGLDLTDAAKKAVASIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtttcaggcaaaagaacttctggccaaagccggagtggctgtacca
cgcggaattgtcgccaagacacctgaagaggctcaggccgcttacggtcaactgggaaca
gcagtcgctgtcgttaaatcgcagattcatgcgggtggtcgagggaagggtcggtttaaa
gagcagcccgagcagcccggggtggtgctggtgaagtcggctgaggatgcagctgccaat
gccagtcgcatgctgggcaataccctcgtgacgatccagacgggtgaagagggtaagaaa
gttcagacgctgctggtcgagcagggtctgaagattgcacgcgagatctacgccgcctgt
gtggttgatcgcgaagtggccggccctgtcatcattgtctcttcggaagggggcatggat
atcgaagaggtggcggcccatcatccggagaagattctcaccgaagcgtttgatcccgtc
tatggtctggaaggctatcaggcccgcaagctggcttttgctctggggctggaagggaat
gctctcaagaatgccgaaaagttcttccggcagctttcgaagttcttcctcgataacgat
tgcagcatggcggaaatcaatccgctggtcgtgacggaagaaggtgaactgctggctctc
gatgccaaggtgacgtttgacgacaacgcacttttccgccatcagaacgtgctggcttat
cgagatctggccgaagaagagccttcggaaatcgaagctcagaagtggggactgagctac
gtcaagcttgacggcaatcttggttgcctcgtgaatggtgccgggctggcgatgtcgacc
atggatttgatcaagctgcacggcggtgagccagccaacttcctcgatgtgggtggtggt
gccaatgtggatcaggtgacggaagccttccgcattatcctcgctgataagaacgtcaaa
gggattctggtcaatatcttcggtggcattatgaagtgcgacacgattgtgacagcactt
ttgacggcctacgacaagattggcattcaggtgccgctggtggttcggctcgaaggaacc
aatgtggaactggcccgcaagatgttggcggaaagtggcaagaagatcacggcaggtctg
gatctgactgacgctgccaaaaaggccgtcgcttcgattgcgtaa

DBGET integrated database retrieval system