KEGG   Planctomyces limnophilus: Plim_2446Help
Entry
Plim_2446         CDS       T01225                                 

Definition
helix-hairpin-helix motif protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
plm  Planctomyces limnophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plim_2446
Enzymes [BR:plm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Plim_2446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3193040..3193663
Genome map
AA seq 207 aa AA seqDB search
MITRITGKLVRLSEDIVRLEIGAFEYEVLVPEFVRRQLQPKLGEVVSLCTIDYLDGNPQQ
GRLVPRLAGFLSETELEFFEMICSVDGMGVKKTLRAMVRPVREIAEAIEEQSIKELTLLP
GVGPAMAERIVAKLRRKMTKFALMVAREVPREADVDRNVLTEAYEALMALGHSSIEARDK
IDQVASQKKKFKDVQDVLTEIYLQSRP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgatcactcgcattactggaaaacttgttcggctgagcgaagacatcgtccgcctggaa
attggtgcattcgaatacgaagttcttgttccggaattcgtccgtcgtcagctccagcct
aaactgggcgaagtcgtcagtctctgcacgatcgactatctcgatggcaatccgcagcag
ggccgcctggtgccgcgcttggccggctttctcagcgaaaccgagctcgaattcttcgaa
atgatctgctccgtcgatggcatgggtgtcaaaaagaccttgcgcgcgatggttcgacct
gtccgtgaaatcgccgaagccatcgaagagcagagcatcaaggaactgacactcctccct
ggcgtcggccccgccatggccgaacggattgtggccaagctccgccgcaaaatgaccaag
ttcgccctgatggtcgctcgcgaagttccccgtgaagccgatgtcgaccgcaacgtcctc
acagaagcttatgaagccctgatggcgttaggccactcctcgatcgaggcccgcgacaaa
atcgaccaggtcgccagccagaagaaaaaattcaaagacgtccaggacgtcctcacagaa
atctacctccaaagccgcccctga

DBGET integrated database retrieval system