KEGG   Planctomyces limnophilus: Plim_2584Help
Entry
Plim_2584         CDS       T01225                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
plm  Planctomyces limnophilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Plim_2584
Enzymes [BR:plm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Plim_2584
Transfer RNA biogenesis [BR:plm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Plim_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3355546..3356484)
Genome map
AA seq 312 aa AA seqDB search
MQSEFLINALSVHLPPILRWAGAIGRRLRSHNISVATKTTGSALTDALTLADLTIQELLV
AALRDVDPIFRHCRIEAEESTGDLHAFAQQSEFVLALDPIDGTKQYRDHTGNGYAVMLHL
RTASEMLYSLVYIPEKGVQGWWVEVTPERVVSGPDDWSRPATDVVRSLVVAEADRPTTSK
KIYVIGFQHRDVIAASEITRCGYEGVAPDEMPGSIYELMASGEFAGSLIHSPNVYDFPVS
MQIARYFGGNACWTDTGEPVHFRETWLDEKADMIRLPRVVACANDPQILAGLINLAKSWH
PVRYRPGDSLVE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgagtttctgatcaatgcgctgagtgtccaccttccacccattttgcgctgg
gcaggtgcgattgggcgacggttacgaagtcacaacatttctgtcgccacaaaaacgacg
ggaagtgcgctgactgatgcactcactctggccgatttaacgatccaggagttgctggtg
gcggctcttcgtgatgtggatccgatcttccggcattgtcgaattgaggcagaagaatca
acaggcgatctgcatgccttcgctcagcaatcggagtttgtgctggcactggatcccatt
gatggaacgaagcagtatcgagaccatacggggaatggatatgccgtgatgctgcatctg
cggacagccagcgaaatgctttattcgctggtgtacatcccggaaaaaggtgtgcagggc
tggtgggtcgaggtaacgccggaacgcgtggtgagtgggccggatgactggtcacgcccc
gcgactgatgtcgtgcgaagtcttgtggttgccgaggctgatcggccgacgacttcgaag
aagatctacgtgattggctttcagcatcgggatgtgatcgcggccagcgagattacgagg
tgcggctacgaaggagtcgcacctgatgagatgccgggaagtatctatgaactgatggct
tccggggaatttgcaggctcgttgattcattcgccgaatgtctacgactttccggtttcg
atgcagattgcgcggtactttggtgggaatgcctgctggacagataccggcgagccggtc
cattttcgtgagacgtggctggatgaaaaagccgatatgattcgtttaccacgggtcgtg
gcctgcgcgaatgacccacagattctggcagggctgatcaatctcgcgaagtcgtggcac
cctgtgcgttaccggcccggtgattcactggtggagtaa

DBGET integrated database retrieval system