KEGG   Planctopirus limnophila: Plim_2613Help
Entry
Plim_2613         CDS       T01225                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
plm  Planctopirus limnophila
Pathway
plm00010  Glycolysis / Gluconeogenesis
plm00030  Pentose phosphate pathway
plm00051  Fructose and mannose metabolism
plm00052  Galactose metabolism
plm00680  Methane metabolism
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01120  Microbial metabolism in diverse environments
plm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_2613
   00030 Pentose phosphate pathway
    Plim_2613
   00051 Fructose and mannose metabolism
    Plim_2613
   00052 Galactose metabolism
    Plim_2613
  Energy metabolism
   00680 Methane metabolism
    Plim_2613
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plim_2613
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Plim_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADG68437
UniProt: D5SQH5
Position
complement(3388383..3389594)
Genome map
AA seq 403 aa AA seqDB search
MLAGNALIGQSGGPTSVINTSLLGVLETARKSKPIQRVFGMRFGIEGVLGDHLVDFSNED
AAVLKGLRGTPGSALGSSRLKLKDEHFPAVLKQLKKYNIRYYFMIGGNDTMDTIHRVVKY
AGENGHEMIGVGVPKTVDNDLFGTDHTPGFPSAARYVAMSVLQGGLLAKDMQRVDQFVVF
QTVGRSAGWLPAAAACARGNGLTAPHVILFPERPFVRDAFLSVVKKAQEKHGFVSIVCGE
GIRDADGQPVSASQTRDKFNNVEFGAMGGTSAAMMLHRMISDEFGWRGEFQVTESLQMCA
ADRGLKLDLDEAYACGKEAVRLALAGTSGVMVTMQRVGKKTDAYQIGFGTIPLGEVANHE
RPMPDNFISKDGFDVTKAFLDYAKPLVGELPTYSVLAAKKGKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaggcaatgcactgattggacaatcgggtgggccgacatctgtgattaataca
tcgcttctgggagtgctggagacagcccggaagagcaagcccattcagcgtgtgtttggc
atgcgatttggcattgaaggtgtcctgggtgaccacctcgttgatttttccaatgaagac
gcggcagtcttgaagggattgcgaggaactccaggttcggcactcggttcgagccgcctg
aagctgaaggatgagcattttccggcagtgctcaagcaactgaaaaagtacaacatccgc
tattacttcatgattggtggtaacgacacgatggatacgatccaccgtgtcgtgaaatat
gcaggggaaaacggccatgagatgattggcgtgggtgtgcctaagacggtcgacaatgat
ctgtttggtactgatcatacgcctggctttccgagtgcggcccgttatgtggccatgagt
gtgctgcagggtgggcttctggcgaaagacatgcagcgcgtcgatcagtttgtcgtgttc
cagacggttggacgcagtgcgggttggctgccagcagcggcggcatgtgcccgaggaaac
ggtctgacagcaccgcacgtgattctcttcccggagcgcccttttgttcgcgatgcattt
ttgagtgtggtcaagaaagctcaagagaagcacgggtttgtttcgattgtctgcggtgaa
gggatccgtgatgccgacggacagccggtcagtgcttcacagactcgtgacaagtttaac
aatgtcgagtttggtgcgatgggcggaaccagtgcggccatgatgctccatcggatgatt
tcggatgagttcggctggcgtggtgaattccaggtgacggaatcgttgcagatgtgtgcg
gcagaccgtgggctgaagcttgatctcgatgaagcctatgcgtgcggtaaagaggctgtt
cgattggctctcgcgggaaccagcggcgtgatggtgacgatgcagcgtgtcgggaagaag
accgacgcgtaccagattggttttggtacgattcctttgggagaagttgccaatcatgag
cgtccgatgccggacaactttatctccaaagatggctttgatgtgacgaaggcctttttg
gactatgcgaagcctttggtgggcgaattgccgacttacagcgtgctggcagcgaagaag
gggaaggcgtag

DBGET integrated database retrieval system