KEGG   Planctomyces limnophilus: Plim_2613Help
Entry
Plim_2613         CDS       T01225                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
plm  Planctomyces limnophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_2613
   01230 Biosynthesis of amino acids
    Plim_2613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_2613
   00030 Pentose phosphate pathway
    Plim_2613
   00051 Fructose and mannose metabolism
    Plim_2613
   00052 Galactose metabolism
    Plim_2613
  Energy metabolism
   00680 Methane metabolism
    Plim_2613
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Plim_2613
Enzymes [BR:plm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plim_2613
Protein phosphatases and associated proteins [BR:plm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plim_2613
Messenger RNA biogenesis [BR:plm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Plim_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3388383..3389594)
Genome map
AA seq 403 aa AA seqDB search
MLAGNALIGQSGGPTSVINTSLLGVLETARKSKPIQRVFGMRFGIEGVLGDHLVDFSNED
AAVLKGLRGTPGSALGSSRLKLKDEHFPAVLKQLKKYNIRYYFMIGGNDTMDTIHRVVKY
AGENGHEMIGVGVPKTVDNDLFGTDHTPGFPSAARYVAMSVLQGGLLAKDMQRVDQFVVF
QTVGRSAGWLPAAAACARGNGLTAPHVILFPERPFVRDAFLSVVKKAQEKHGFVSIVCGE
GIRDADGQPVSASQTRDKFNNVEFGAMGGTSAAMMLHRMISDEFGWRGEFQVTESLQMCA
ADRGLKLDLDEAYACGKEAVRLALAGTSGVMVTMQRVGKKTDAYQIGFGTIPLGEVANHE
RPMPDNFISKDGFDVTKAFLDYAKPLVGELPTYSVLAAKKGKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaggcaatgcactgattggacaatcgggtgggccgacatctgtgattaataca
tcgcttctgggagtgctggagacagcccggaagagcaagcccattcagcgtgtgtttggc
atgcgatttggcattgaaggtgtcctgggtgaccacctcgttgatttttccaatgaagac
gcggcagtcttgaagggattgcgaggaactccaggttcggcactcggttcgagccgcctg
aagctgaaggatgagcattttccggcagtgctcaagcaactgaaaaagtacaacatccgc
tattacttcatgattggtggtaacgacacgatggatacgatccaccgtgtcgtgaaatat
gcaggggaaaacggccatgagatgattggcgtgggtgtgcctaagacggtcgacaatgat
ctgtttggtactgatcatacgcctggctttccgagtgcggcccgttatgtggccatgagt
gtgctgcagggtgggcttctggcgaaagacatgcagcgcgtcgatcagtttgtcgtgttc
cagacggttggacgcagtgcgggttggctgccagcagcggcggcatgtgcccgaggaaac
ggtctgacagcaccgcacgtgattctcttcccggagcgcccttttgttcgcgatgcattt
ttgagtgtggtcaagaaagctcaagagaagcacgggtttgtttcgattgtctgcggtgaa
gggatccgtgatgccgacggacagccggtcagtgcttcacagactcgtgacaagtttaac
aatgtcgagtttggtgcgatgggcggaaccagtgcggccatgatgctccatcggatgatt
tcggatgagttcggctggcgtggtgaattccaggtgacggaatcgttgcagatgtgtgcg
gcagaccgtgggctgaagcttgatctcgatgaagcctatgcgtgcggtaaagaggctgtt
cgattggctctcgcgggaaccagcggcgtgatggtgacgatgcagcgtgtcgggaagaag
accgacgcgtaccagattggttttggtacgattcctttgggagaagttgccaatcatgag
cgtccgatgccggacaactttatctccaaagatggctttgatgtgacgaaggcctttttg
gactatgcgaagcctttggtgggcgaattgccgacttacagcgtgctggcagcgaagaag
gggaaggcgtag

DBGET integrated database retrieval system