KEGG   Planctomyces limnophilus: Plim_2615Help
Entry
Plim_2615         CDS       T01225                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
plm  Planctomyces limnophilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Plim_2615
Enzymes [BR:plm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Plim_2615
Peptidases [BR:plm01002]
 Cysteine Peptidases
  Family C44
   Plim_2615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3390894..3392807
Genome map
AA seq 637 aa AA seqDB search
MCGVVGFYAPQAPMPLHEAEHVLRQMTNRLEHRGPDDAGCWIDAQSGIALGQTRLAIVDL
SPLGHQPMDSANGEWTIVFNGEIYNFHTLRQELASLGVTFKGHSDTEVLVEGFNIWGVRP
TIEKCVGMFAIAAWNHRERELTLVRDRLGKKPLYYGCIGQTWLFASELKALHPHPRFEPR
LNRNAIPLYLRHNYIPGPYSIYEHIWKLQPGTILTINAQGQSTGPQTYWSMRKDASAKGL
ANIFQGTFDEALQQLEQLLENAIALRMIADVPLGSFLSGGIDSSLVTALMQKVSSKPVRT
FSIGFEDPAYDEAPFAKAIAQHLKTDHIEHIVSGREALDVIPLLPEMFDEPFADSSQIPT
YLVSKLARQSVTVALSGDGGDEFFCGYRRYFQTQQIARMLQRIPGPARSIASILCQWAVP
LAKTVSLRWQKRLNHASHLFSHAESDDLYLSHMQYWTEQSPGTIGIPWSGTEFMNRETWL
ASPHAEERWMDLDSRTYLPDDILTKVDRTSMAVALETRAPLIDHRVIEFAWTLPLDFKRQ
DNNGKIPLKRILNKYVPSELFERPKKGFGVPMERWLCEDLRDWAEDLLSEQSLNATGFYN
TPLIRQRWHAHTHGQPVWNYHLWGVLMLQAWLRTWPH
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtgtcgttggtttttacgctcctcaggccccgatgccgctccatgaggcagag
catgttctccgtcagatgaccaaccgcctcgagcatcgcggcccggatgacgccggttgc
tggatcgatgcgcaatcaggcattgcactcggtcagactcgactggccattgtcgatctt
tcaccacttggccaccaaccgatggattctgccaatggcgaatggacaatcgtcttcaat
ggagaaatctataactttcacacactccgccaggaactggcctcactcggagtcaccttc
aaaggccattccgataccgaagtgctcgtcgaaggtttcaacatctggggggttcgcccc
accatcgaaaaatgcgtcggtatgtttgccatcgccgcctggaaccatcgcgagcgggaa
ctcactctcgtccgtgatcgactgggaaaaaagcccctctactatggctgcatcggtcaa
acgtggttgtttgcatccgaactcaaagctctgcaccctcacccccgctttgaaccaagg
ctcaaccgaaatgccattcctctctacctgaggcataactacatccccggcccctattcc
atctacgaacacatctggaaactacagccgggaaccatcctcaccatcaatgcccagggc
cagtccacaggcccgcagacttattggagcatgcgcaaagatgcctctgccaaaggtctg
gccaatatcttccagggaaccttcgacgaagccctccagcaactcgaacaactgctcgag
aacgccatcgcactgcgcatgattgccgatgtccccctcggttcttttctctctggcggc
atcgattcatccctcgtcaccgctttgatgcagaaggtgtcgtccaaacctgtccgcact
ttctcgattggttttgaagacccagcctacgacgaagccccctttgccaaagcgatcgcc
cagcacttaaaaactgatcacatcgagcatattgtctcaggccgcgaagccctggatgtc
atcccgctcctcccggaaatgttcgacgaaccatttgccgattcatcacaaatcccaacc
tacctcgtctcaaagctcgccagacaatcagtgaccgtggcactctcgggcgatggtggt
gatgagttcttttgcggctaccgccgctatttccaaacccagcagattgccaggatgctg
cagcgaattcctggtcctgccagatcgatcgcctcaatcctttgtcaatgggctgtacca
ttagcaaaaacggtttcgcttcgatggcaaaagagactcaaccacgccagccatttgttt
tcgcatgccgagagcgacgatctttatctgtcacacatgcagtattggactgagcaatct
cccggcaccatcggcattccctggagcggcaccgagttcatgaatcgtgagacctggctg
gcatcacctcatgccgaagagcgctggatggatctcgattctcgcacctacctgcccgac
gacatcctcacaaaagtcgatcgtaccagtatggcagtggcactcgaaacccgggccccg
ctcattgatcatcgcgtcatcgagttcgcctggacattacctctcgacttcaagcgtcaa
gacaacaacggcaagatccctctcaagcgtattctcaacaaatacgtcccgtcagaactt
ttcgaacgccccaaaaagggattcggcgtgccgatggaacgctggctctgtgaggacctt
cgcgattgggccgaagacctgctctcagaacaaagcctgaacgccaccggtttctataac
actcctctcatcaggcagcgctggcacgcccatacccacggccaaccggtctggaattac
catctctggggagtgctcatgttgcaggcctggctgcgaacctggccacattga

DBGET integrated database retrieval system