KEGG   Planctopirus limnophila: Plim_2633Help
Entry
Plim_2633         CDS       T01225                                 

Definition
(GenBank) DNA-formamidopyrimidine glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
plm  Planctopirus limnophila
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:plm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Plim_2633
Enzymes [BR:plm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Plim_2633
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Plim_2633
DNA repair and recombination proteins [BR:plm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Plim_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3413767..3414672)
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETMVRGVRSALERHRLVALRILDTAYRSLTILPDERTVCERVAGQVIQRVWRL
GKRVVLDFSDGSTLTIEPRMTGLMLLEDPPSAEHLRLEFRLAPAGSHGSPTKGKGKSTSV
WFWDRRGLGTVTWRPPGELEKLLSSHQIGPDALSLAAEGWKAALGKTSRPVKVAMLDQKL
VAGVGNLYASEILHRAGISPLSASSQLHPEEWERLANAARQILELAIQYEGSTLSDGTYR
NALNKSGGYQNEHLVYAKAGEVCSTCRSGVILRIVQAQRSTFYCEHCQTVAKKRPGKQKK
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaactgccggaagtggagaccatggttcgaggcgttcgatcagcactcgaacgt
cacaggctcgtcgctctcagaattcttgacacagcttatcggtcgctcacgatccttcct
gacgagcgaacggtctgtgagcgtgtagctggccaggtgattcagcgcgtctggcggctg
ggtaaacgggtggtgctcgatttttcggatggatcgacactgacaattgagccgagaatg
acgggtttgatgctgctggaagacccgcccagtgccgagcacttgcgactggagtttcgc
ctcgcaccggcgggctcgcatggttccccgacgaaaggaaagggaaaatccacatcggtc
tggttctgggatcgtcggggattgggaacagtgacctggagaccgccgggggagctggag
aagcttttatcaagccatcagatcgggccagatgcgttgtcactggctgctgagggatgg
aaagcggcactcgggaaaacgtcgcgtcctgtcaaagtggccatgctggatcagaagctg
gtggcaggagtggggaatctctacgccagcgaaattctgcatcgggctgggatctctccc
ttatctgcttccagtcaactccacccagaagaatgggaacgtctggcaaatgctgcccgg
cagatcctcgaactggccattcagtatgaaggttcgacactttctgatggaacctatcgc
aatgcgctcaataaatcggggggatatcagaatgaacacctcgtttatgccaaagccggt
gaggtttgttcaacttgccgatcgggtgtgatcctgaggattgtgcaggcccagcgatcc
acgttttattgcgaacactgtcagacagttgcgaagaagcggcccggcaaacagaaaaaa
tcctga

DBGET integrated database retrieval system