KEGG   Planctomyces limnophilus: Plim_2769Help
Entry
Plim_2769         CDS       T01225                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
plm  Planctomyces limnophilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:plm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3593831..3594757
Genome map
AA seq 308 aa AA seqDB search
MQLQQSENRLIVQAPAKLNLSLRILARRPDGFHEIETVMVSIQHYDTLSFAPSSQTDISF
RFEDLTHHPLATTTHSFADETALVPQDHTNLVVRAALLLKEYAKVDCGAEILLQKRIPAA
AGLAGGSSNAAATLAALNQLWNLRLTLQELSQLASQLGSDIPFFLCGKPMAVCRGRGEII
EPVELQEKLWFVVAKPPAGLSTALVYRHCQPTQNSPSIAPLLSNLAKGDQISAAHALHNG
LQAAAVELCPAIRQLESTFANLDVIAHQMSGSGTAYFGWCRSEAAAHTAAQQLTHLGLAQ
VFVACSGL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgcagttacaacaatctgaaaaccgtcttattgttcaggcacccgccaaactcaacctc
tctctgcggattctcgcgcgtcgtcccgatggttttcacgagatcgaaacggtcatggtt
tccatccagcattacgacacgctctccttcgccccctcttcccaaactgacatttcattt
cgatttgaggatctgacgcatcatccattagcaaccacaacacattcgttcgcggatgaa
acggctcttgtccctcaggatcacaccaatctggttgttcgtgcggcactcctgctgaag
gaatatgcaaaggttgactgcggagccgagatccttctgcagaaaagaattcccgccgcg
gctggccttgccggcggttccagtaatgccgccgccacgctggctgctctcaatcagtta
tggaatcttcggttaactttgcaggaactttctcagctcgcgtcacagttaggaagtgat
attcccttcttcctttgcggcaaaccgatggcagtctgccgcgggcgtggcgagatcatt
gagcctgtcgaacttcaggaaaagctgtggtttgttgtagcaaaaccaccagctgggctc
tcgacagcactcgtctaccgacattgccaacccacccagaattctccctcaatcgctcca
ttgctcagcaacctggcgaagggagatcaaatcagcgcggcacatgctttgcataatggt
cttcaagcagcagcagtcgagctctgccctgcaattcgtcagctcgagtccacttttgca
aaccttgatgtgattgcccatcaaatgagcggaagcgggactgcttacttcggttggtgc
agaagcgaagcggcagctcacactgcagcccagcaactcactcacctgggactggcacag
gtcttcgtggcttgctccggattgtaa

DBGET integrated database retrieval system