KEGG   Planctomyces limnophilus: Plim_2909Help
Entry
Plim_2909         CDS       T01225                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
plm  Planctomyces limnophilus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Plim_2909
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Plim_2909
Enzymes [BR:plm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Plim_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764913..3765509
Genome map
AA seq 198 aa AA seqDB search
MRSLVRGLMILALVSAAVVTGLMTKGDKMTTVAADATGSIYRHKLTTLSGEPVELSKYKG
KVILFVNVASACGYTGQYKPLQAISEKYKDQGLEVVGVPCNQFGGQEPGSADEIQTFCSN
KYGVTFDLLAKTDVNGPKASPLYVDLKAQSPNGNGDIGWNFEKFLVSRDGKVVGRYKSGV
KPDSKELVSAIEAELAKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtctggttcgaggtctaatgattctagcgctcgtaagtgcagcagttgtaact
ggtctgatgacaaaaggagacaaaatgacaaccgtcgcggctgatgcaaccggttcaatc
tatcggcacaaactcacaactctcagtggtgaacccgtcgaactctccaagtacaaaggc
aaagtgatcctcttcgtcaacgtcgccagtgcctgcggctacacaggccaatacaagcca
ctgcaagccatctcggaaaagtacaaagatcagggtctggaagtcgtgggcgttccctgc
aatcagttcggcggacaggaacccggatcagccgatgagattcagactttctgctcaaac
aagtatggtgtcactttcgacctgctggccaaaaccgatgtgaatggccccaaggcctct
cctctttatgtcgatttgaaggcccagagccccaatggcaatggtgatatcggctggaac
ttcgaaaagttcctcgtctcgcgtgatggcaaagtcgtgggccgctacaagtcgggcgtc
aagccagattccaaggaactggtctccgcgattgaagccgaattggctaagaagtaa

DBGET integrated database retrieval system