KEGG   Planctopirus limnophilus: Plim_2963Help
Entry
Plim_2963         CDS       T01225                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plm  Planctopirus limnophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plim_2963
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plim_2963
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plim_2963
Enzymes [BR:plm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plim_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3835382..3836833
Genome map
AA seq 483 aa AA seqDB search
MTPPTAAITPPVAKLFRSSPTDAAFQVCIEPTCRATYAVDQTLTSCTACGSLLDIGYDWN
RIRVPGSMRWFEQRWSRRNQPLDFSGVWRFRELFPFAPEESIVTIGEGQTILQNSAAVAS
YVGVQHGNLFLQYEGLNPSGSFKDNGMTAAATHARMVGAHVAACASTGNTSASLAIYASS
TKAFRTVVFIGSGKIAFGKLSQALDYDACTVQIMGDFDDALARVREVSSERGIYLCNSVN
PFRLEGQKSIMYRVLEGLGWEVPDWIVVPGGNLGNSSSFGKALAELKQLGLIDRIPRLAV
INAHGANTLQQLYNEHHVRWNNGNVPLETINRFYAEMDLNSRRADTIASAIEINRPVNLM
KCLRALETCDGVVRDVHDQEILDAKAQVGAGGFGCEPASAASVAGARLLRAQGVIAPSDR
VVCILTGHQLKDPDATVAYHSGNRDMFESKLARRGVTETPFRNMPQGVENDLGKILELLA
RLD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacctactgccgccatcactccccctgtcgccaaacttttccgctcctcaccg
accgatgcggctttccaggtctgtattgaaccgacttgccgggcgacctatgccgtcgat
cagacactcacttcatgcacagcctgcggaagtctgctcgatattggctacgactggaat
cgaatccgcgtgccgggctcgatgcgctggttcgaacagcgctggagccgccgcaatcag
cctctcgatttcagcggcgtctggcgttttcgcgagttgttccccttcgctcccgaagag
tcgattgtcaccattggagaaggtcagacgattctccagaactcagccgctgtagccagt
tacgtcggtgtgcagcacggaaatctgtttttgcagtacgaagggctcaatccctccggc
agcttcaaagataacggcatgactgccgccgccacacatgcccgcatggtgggagctcat
gtggctgcatgtgcctcgacaggcaatacgagcgcatcactggccatctacgccagctcg
accaaagccttcaggactgtggtgttcatcgggagtggcaagattgccttcgggaagctc
tcacaggctcttgattacgatgcctgcacagtccagatcatgggtgactttgacgacgcc
ctggctcgcgttcgcgaagtttcttccgagcgaggcatctacttgtgcaacagtgtcaac
ccgttccgcctcgaaggccagaagtcgatcatgtatcgagttctcgaaggtctcggctgg
gaagttcctgactggattgtggttcccggtggtaatctcgggaacagcagttcgttcggc
aaggccttggccgaactgaagcaactgggcctgattgatcgcatcccgcgactggccgtc
atcaacgctcacggagccaacactctgcagcagctttacaatgagcatcatgtccgctgg
aataatggcaatgttcctttggagaccatcaaccggttttatgccgaaatggatctcaat
tcccgccgtgccgataccattgccagtgccattgagatcaaccgccccgtcaatctgatg
aagtgcctgcgagctctcgaaacctgtgacggcgtcgttcgcgatgttcatgatcaggaa
attctcgacgccaaggcgcaggtgggagcaggcggtttcggctgcgagccagccagtgct
gccagtgtggccggtgcccgtcttctgcgggcacaaggtgtaatcgcgccttccgaccga
gtggtgtgcattctcactggccatcaactcaaagatcccgatgccaccgtcgcgtatcac
tcggggaatcgtgacatgtttgaatcgaagctggctcgccgtggcgtgaccgaaacaccc
ttccgcaatatgccgcagggtgtcgagaatgatctggggaagattctggaactcctcgcc
cggctcgattag

DBGET integrated database retrieval system