KEGG   Planctomyces limnophilus: Plim_2963Help
Entry
Plim_2963         CDS       T01225                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plm  Planctomyces limnophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plim_2963
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plim_2963
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plim_2963
Enzymes [BR:plm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plim_2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3835382..3836833
Genome map
AA seq 483 aa AA seqDB search
MTPPTAAITPPVAKLFRSSPTDAAFQVCIEPTCRATYAVDQTLTSCTACGSLLDIGYDWN
RIRVPGSMRWFEQRWSRRNQPLDFSGVWRFRELFPFAPEESIVTIGEGQTILQNSAAVAS
YVGVQHGNLFLQYEGLNPSGSFKDNGMTAAATHARMVGAHVAACASTGNTSASLAIYASS
TKAFRTVVFIGSGKIAFGKLSQALDYDACTVQIMGDFDDALARVREVSSERGIYLCNSVN
PFRLEGQKSIMYRVLEGLGWEVPDWIVVPGGNLGNSSSFGKALAELKQLGLIDRIPRLAV
INAHGANTLQQLYNEHHVRWNNGNVPLETINRFYAEMDLNSRRADTIASAIEINRPVNLM
KCLRALETCDGVVRDVHDQEILDAKAQVGAGGFGCEPASAASVAGARLLRAQGVIAPSDR
VVCILTGHQLKDPDATVAYHSGNRDMFESKLARRGVTETPFRNMPQGVENDLGKILELLA
RLD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacctactgccgccatcactccccctgtcgccaaacttttccgctcctcaccg
accgatgcggctttccaggtctgtattgaaccgacttgccgggcgacctatgccgtcgat
cagacactcacttcatgcacagcctgcggaagtctgctcgatattggctacgactggaat
cgaatccgcgtgccgggctcgatgcgctggttcgaacagcgctggagccgccgcaatcag
cctctcgatttcagcggcgtctggcgttttcgcgagttgttccccttcgctcccgaagag
tcgattgtcaccattggagaaggtcagacgattctccagaactcagccgctgtagccagt
tacgtcggtgtgcagcacggaaatctgtttttgcagtacgaagggctcaatccctccggc
agcttcaaagataacggcatgactgccgccgccacacatgcccgcatggtgggagctcat
gtggctgcatgtgcctcgacaggcaatacgagcgcatcactggccatctacgccagctcg
accaaagccttcaggactgtggtgttcatcgggagtggcaagattgccttcgggaagctc
tcacaggctcttgattacgatgcctgcacagtccagatcatgggtgactttgacgacgcc
ctggctcgcgttcgcgaagtttcttccgagcgaggcatctacttgtgcaacagtgtcaac
ccgttccgcctcgaaggccagaagtcgatcatgtatcgagttctcgaaggtctcggctgg
gaagttcctgactggattgtggttcccggtggtaatctcgggaacagcagttcgttcggc
aaggccttggccgaactgaagcaactgggcctgattgatcgcatcccgcgactggccgtc
atcaacgctcacggagccaacactctgcagcagctttacaatgagcatcatgtccgctgg
aataatggcaatgttcctttggagaccatcaaccggttttatgccgaaatggatctcaat
tcccgccgtgccgataccattgccagtgccattgagatcaaccgccccgtcaatctgatg
aagtgcctgcgagctctcgaaacctgtgacggcgtcgttcgcgatgttcatgatcaggaa
attctcgacgccaaggcgcaggtgggagcaggcggtttcggctgcgagccagccagtgct
gccagtgtggccggtgcccgtcttctgcgggcacaaggtgtaatcgcgccttccgaccga
gtggtgtgcattctcactggccatcaactcaaagatcccgatgccaccgtcgcgtatcac
tcggggaatcgtgacatgtttgaatcgaagctggctcgccgtggcgtgaccgaaacaccc
ttccgcaatatgccgcagggtgtcgagaatgatctggggaagattctggaactcctcgcc
cggctcgattag

DBGET integrated database retrieval system