KEGG   Planctomyces limnophilus: Plim_3008Help
Entry
Plim_3008         CDS       T01225                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
plm  Planctomyces limnophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:plm00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:plm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3891897..3893201
Genome map
AA seq 434 aa AA seqDB search
MDRQHAFLHSQDSHSSASSEESRRISFPDRLWITGFGLGCLTLTTLLGCPGQPLKTTPTD
PTKSATSSTTADPAEAAAMKGQPMLTVQSEPYGTTPEGAAITQYTLQNESGMKVSLINLG
ATVTSVEVPDREGKLANVTLNFPDLDGYLKNGPYFGGICGRFANRIANARFTLEGNEYNL
FKNNGEHTLHGGKTGFNKLVWKAAPFETPGSAGVTFELVSPDGDEGYPGQLAVRVSYALN
TKNELAISYEATTDKATVLNLTNHCYWNLAGAGNGTVLGEILELKCEKYLPVDEGGIPTG
ELVAVNGTAMDFSKPHAIGDAIAQTVNGHGGYDHCYVVNGTPGELRPAAKVIDPSSGRGM
EILTTEPGIQFYTGNFLNGTAENGNAVQHGAFCLEAQHFPDSPNRPEFPTTTLKPGETYK
QTTIHRFFVEPAAK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacaacacgcgtttcttcattctcaagatagccacagttctgcctcatcagag
gagagtcgtcgcatatcgtttccagatagattatggatcactggttttggcctgggctgc
ctcacattgaccacactgctgggttgtcccggacaacctctgaaaacaactcctaccgac
cccacaaagtcggccacatcatccaccactgctgacccggctgaagccgccgccatgaaa
ggccaaccgatgctgactgtgcaatccgagccttacggaacaacaccagaaggagctgcg
attacacagtacacgctccaaaacgaatccggaatgaaagtctcgctgatcaatctgggg
gccacagtcacctctgtcgaagtgccggatcgtgaaggcaaactggccaatgtgacgctg
aatttccccgacctggatggctacctcaaaaatggcccttactttggaggaatctgcggc
cggttcgccaatcgaatcgccaatgcccgctttactcttgaaggaaacgaatacaacctc
ttcaagaacaatggcgaacacacacttcacggcggcaaaacaggcttcaacaaactggtc
tggaaagctgctccgtttgagaccccaggctctgccggtgtcacctttgagctggtaagc
cccgatggagatgaaggatatcccggtcaactggcggttcgagtctcatatgcactcaac
accaagaacgaacttgccatcagctatgaagcaaccacggataaagccaccgttctgaat
ctgaccaatcactgttactggaatctggctggtgccgggaatggcacagttctgggcgag
atcctcgaattgaagtgcgaaaaatacctccccgtcgatgaaggtgggattcccacggga
gaactggttgccgtcaacgggacagcgatggatttctccaagccccacgccatcggcgat
gcgatcgcccagacggtcaatggccacggtggatacgaccactgctatgtggtcaatggg
actcccggcgagttgcgtcctgccgctaaagtgattgacccttcttcaggccgagggatg
gaaattctgacaaccgaaccagggattcagttctacacagggaatttcctcaatggcacg
gccgaaaacgggaacgccgtccaacatggtgccttctgcctcgaagcgcagcactttccc
gattcaccgaatcgtccagagttccccacaacgacactcaagccaggtgaaacctacaag
cagacgaccattcatcgcttctttgtcgaacctgcggccaagtag

DBGET integrated database retrieval system