KEGG   Planctomyces limnophilus: Plim_3028Help
Entry
Plim_3028         CDS       T01225                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
plm  Planctomyces limnophilus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:plm00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:plm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3924175..3925497)
Genome map
AA seq 440 aa AA seqDB search
MTNATISAGWNRREFMTAAGTLVVATGVNPLLAADQPIREVIGPVLGHIDHRQAYLFCRA
PGATSVRLSLENAQGQRIQQLESAPEKVHDDCVTFSLQNLQPGTTYRGQLVTTGSTSLFG
PDNFDGKFTFTTPVAPETPATITLGLGSCVSSTEFDDLWSQIAAHQVDGFCLLGDTPYID
TNDLSRNRLARRKFWGTLPTLRMLATKIPFWNTWDDHDFGKNDSDGLMPKKEDIRQAFLE
YNALANYGENDEGIYTSFRRGPVEVWLIDDRWFSQTASSWADPAQKTCLGQAQWNWLQRT
LKASTAPFKILCTGMVWYPKGNKEKDHWETYSAEREALFAWIKQQQISGVMLISGDIHVS
RHHIYGPERVGYPLHECVVSPMHASVIPSLDVQHPARVWSKPAPNVFLKLVASNLESQPK
LTATWINRQGEELHSFEWIA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgcaacaatttcagccgggtggaatcgccgagagtttatgaccgctgcgggc
actttggttgtggccacaggcgtcaatcctttgctggctgccgatcagcccattcgcgaa
gtcatcgggcctgtgttggggcatattgatcatcgtcaagcctacttattctgccgcgct
cctggtgcgacatccgttcgcctgagcctcgagaatgcacaagggcagagaatacagcaa
ttggaatcggctcccgagaaagttcacgatgattgtgtgaccttctctctgcagaacctc
cagcccggtacgacctatcgcggccagttggtgaccacgggttcaacctcactgttcggt
cctgataactttgatggaaagttcaccttcacgacacccgtagcacccgaaacgcctgcc
acaatcacgctggggctgggttcctgtgtgtcgagcaccgagttcgatgatttatggagc
cagatcgccgctcatcaagttgatggcttctgcctgttgggcgataccccttacatcgat
accaacgacctcagcaggaaccgactcgcccggcgaaagttctgggggacactccccacc
ctcagaatgctcgctacgaaaatccccttctggaacacctgggatgaccacgacttcggc
aagaatgattccgatggactgatgccgaaaaaggaagatatccgccaggcgttcctcgaa
tacaacgctctggcaaattacggagaaaacgacgaggggatctatacctcgtttcgccga
gggcctgtcgaagtctggctgattgatgatcgctggttctcacagacagccagttcctgg
gccgacccggcacaaaagacctgcctgggccaagcgcagtggaattggcttcagcgaaca
ttgaaggcttcgacggccccattcaaaattctttgtaccggcatggtctggtatcccaag
gggaacaaagagaaagatcactgggagacctacagtgccgagcgcgaagcactctttgcc
tggattaagcagcagcagatcagcggcgtcatgctaatctcgggagatatccatgtcagc
cggcatcatatttatgggccggagcgagtcggttatccactccacgaatgtgttgtttcg
ccgatgcacgcttcggtcatcccttcgctcgatgtgcagcatccagcccgtgtctggagc
aaacccgctccgaatgtgttcctcaagctcgttgccagcaatctggaaagccaacccaaa
ctgactgccacctggatcaacaggcagggcgaagaactccactcttttgaatggattgcc
tga

DBGET integrated database retrieval system