KEGG   Planctopirus limnophila: Plim_3190Help
Entry
Plim_3190         CDS       T01225                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
plm  Planctopirus limnophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plim_3190
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plim_3190
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Plim_3190
Enzymes [BR:plm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Plim_3190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4125570..4126385)
Genome map
AA seq 271 aa AA seqDB search
MSESPITKALSARRLAGEMSFIPFIAAGDPDLPSTIRLIQTLSTAGADLIEIGFPYSDPI
ADGPVIQSSYTRALGKHLKLADLFATIEQVSKTISTPLVGMVSFAIIFRTGTRSFLEAAK
KAGFAGLIIPDLPGDEATEFAALTKEFGIDLIQLVAPTTPAARMDKILATASGFIYCIAV
AGTTGVRDAAAHEIEAGLKLLREKTQLPLCVGFGVSQAAQIEALRGKADGAIVGSAIVRH
LDGAETPAGFEKSLTSIQQFAEQLAAAAHHS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatcaccaatcaccaaagcactttccgcccggcgtcttgcgggagagatgtca
tttattccgtttattgccgctggcgatcccgatcttccctcgaccatccggctgattcag
acactctcaactgccggagccgatctcattgaaatcgggttcccgtatagcgacccgatt
gccgacggtccggtgattcaatcgtcctatacgcgagcattagggaaacatctcaagctg
gccgatctcttcgcgaccatcgagcaggtctcaaaaacgatttcgacaccactcgtgggg
atggtgtcgtttgccatcatcttccgcacagggacacgttcctttctcgaagccgcaaag
aaggctggctttgccggtctgattattcccgatctccctggggatgaagccacagaattt
gcggcactcacgaaagagttcggcatcgatctgattcaattggtcgcccccacgacaccc
gccgcccggatggacaagatcctggccacagcctcaggattcatttactgtattgccgtg
gcaggaacgacgggagtccgcgatgccgctgcccacgagatcgaggcgggacttaagctc
ctgcgtgaaaagacgcagcttcctttgtgcgtgggctttggagtcagccaggccgcccag
attgaagcccttcgcgggaaagccgacggtgcgattgtcggttctgccattgtgaggcat
ctcgacggtgccgagactcccgcaggctttgaaaagtcgctgacctcgatccaacagttc
gccgagcaactcgccgccgccgctcatcactcgtga

DBGET integrated database retrieval system