KEGG   Planctopirus limnophila: Plim_3191Help
Entry
Plim_3191         CDS       T01225                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
plm  Planctopirus limnophila
Pathway
plm00260  Glycine, serine and threonine metabolism
plm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01130  Biosynthesis of antibiotics
plm01230  Biosynthesis of amino acids
Module
plm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plim_3191
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Plim_3191
Enzymes [BR:plm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Plim_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG69005
UniProt: D5STH6
Position
complement(4126487..4127704)
Genome map
AA seq 405 aa AA seqDB search
MSAAITHPISQVPDAQGRFGEFGRRFVPETLMYALEELAQAYESAKKDPEFAATLEGLLK
HFVGRPNPLYFAERLTRMSGGAKIYFKREDLNHTGAHKINNALGQALLTMRMGKTRIIAE
TGAGQHGVATATACAHFGIPCTVFMGEEDVRRQKLNVFIMRTMGAEVRPVTSGSRTLRDA
INEAMRDWMSSVKNTHYIIGSVVGPHPFPMIVRDFQSVIGREARAQCFEMIGGLPTEIVA
CVGGGSNAAGMFYPFVDDESVRITGVEAGGRSPKPGDHASALSFGNKGILHGSYSYVLQD
EDGQTSDVHSVSAGLDYPGVGPEHAYWKDSGRVQYTSCSDDEALAAMQLMARTEGILPAL
ETSHAISYTLKRASEMSPDESIVVCLSGRGDKDLNEVARLTGQQI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagccatcactcatccgatctctcaggttcccgatgcccaggggcgttttggg
gagttcgggagacgatttgtccctgagaccttgatgtacgccctggaagaactggctcag
gcgtacgagagtgcgaaaaaagaccccgagtttgctgcaacactcgaaggcttactcaag
cactttgtgggccggcctaacccgctctacttcgcagaacgacttacccgcatgagcggt
ggtgcgaagatttatttcaagcgggaagatctcaaccatacgggtgcccataagatcaac
aatgctctcgggcaggctctcctgacgatgcggatgggcaagacccgcatcattgctgaa
acaggtgccggccagcacggtgtcgccaccgccaccgcctgcgctcacttcggtattccc
tgtacggtctttatgggcgaagaagatgttcgccgacagaagctgaacgtcttcatcatg
cgaacgatgggagccgaagttcgacctgtgacatcgggttcgcgaactttacgcgatgcc
attaacgaagcgatgcgtgactggatgtcttcggtcaagaatacgcattacatcattggt
tcggtggttgggccgcacccctttccgatgatcgttcgcgatttccaatcggtgattggc
cgggaagcccgtgctcaatgctttgagatgatcggtggattgccgacagagatcgtggcc
tgtgtgggtggcggctcgaatgctgccggcatgttttatccctttgttgacgatgaatcg
gtgcgaattactggcgttgaagcgggtggccgcagccctaagcccggcgatcatgccagt
gccctctcgtttggaaacaaagggattctgcatggcagctacagctacgttttgcaggat
gaagatggccagacctccgatgtccattcggtatcggccgggctcgattatcccggtgtc
ggccccgaacatgcctactggaaagattccggccgcgtgcagtacaccagttgcagcgat
gacgaggctctggcggccatgcaactgatggcacgaacagagggcattcttcctgcactc
gaaacatctcacgccatctcttacacactcaagcgtgccagtgaaatgtcgccggatgaa
tccatcgtcgtctgcctttcgggccgtggcgataaagacctcaatgaagtcgcacggctg
accggccagcagatttaa

DBGET integrated database retrieval system