KEGG   Planctomyces limnophilus: Plim_3364Help
Entry
Plim_3364         CDS       T01225                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
plm  Planctomyces limnophilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Plim_3364
Enzymes [BR:plm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Plim_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4354769..4355917)
Genome map
AA seq 382 aa AA seqDB search
MKQIALLGSTGSIGLSTLDVVRSDPASFQLFALAAHRRVQELASQCHEFHPRYAVIADPS
LAGEIDRSLFPPETQLLFGEEGIEQVATDPQVGIVVSAIVGAAGLKGTWAAAQSGKRVAL
ANKESLVVAGALVTNAAKASGGEILPVDSEHSAIFQCLAAGNRHEVARIHLTASGGPFRK
SSRAELDKVTVAAALDHPTWKMGPKITIDSATMMNKALEVIEARWLFDASVDELNVVVHP
QSIIHSLVEYVDGSILAQLSPPDMRLPIQYALSWPQRKSGFARKMNWFESQTMEFFPPDF
DRFPALKLGFEVAAAGGGSGAVLNAANEVAVERFLNNDLKFMKIPQVCGEVLAAHTHSTN
PSLSELLALDAWAREETRRWKA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagattgccctgctgggttcaactggttcgatcggcttaagcacactcgatgtg
gtccgcagtgacccagcatcgtttcaactctttgcacttgccgctcatcgtcgcgtgcag
gaactcgcctcgcaatgccacgaatttcatccgcgctatgccgtcattgccgatccatcg
ctggcgggtgagatcgatcgatcgctgtttccccctgagactcaactgctgtttggcgaa
gaagggatcgagcaggtcgcaaccgatcctcaggtcgggattgtcgtttcggcaattgtc
ggggccgccggcctcaagggaacctgggccgccgcacaatcgggcaaacgggtcgctttg
gccaataaagaaagcctggttgtcgctggtgcactcgtcaccaatgcggcgaaggcttct
ggcggtgaaattctgcctgttgacagtgaacacagcgcgatctttcagtgcctcgctgcc
gggaatcgccacgaggtggcccgcattcatttgacggccagtggtgggccttttcgcaag
tcctcacgtgccgaactcgacaaggtgacagttgctgctgccctcgatcatcccacctgg
aagatgggtccgaagatcaccatcgacagtgcgacaatgatgaacaaggccctcgaagtg
atcgaagcccgctggctgttcgatgccagcgtggacgagttaaacgtcgtggtgcatccc
caatcgatcattcactcgctggtggaatatgtggatggctcgattttggctcagctttct
ccgcccgatatgcgcctgcccattcaatatgcgttatcatggccccagcgaaaatctggt
tttgctcgtaagatgaactggttcgaatctcagacgatggagtttttcccccctgatttc
gaccggtttcctgccttgaagctgggttttgaagttgctgcagccggtggcggcagcgga
gcagtgctgaatgcggccaacgaagtcgctgtcgaacgatttttaaataacgatttgaag
ttcatgaagattccccaggtttgtggggaagtactagccgcgcacacgcactccaccaat
ccttcactgagtgaattgttggcactggatgcctgggcacgcgaggagacgcgacgttgg
aaagcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system