KEGG   Planctomyces limnophilus: Plim_3533Help
Entry
Plim_3533         CDS       T01225                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plm  Planctomyces limnophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plim_3533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_3533
   00020 Citrate cycle (TCA cycle)
    Plim_3533
   00620 Pyruvate metabolism
    Plim_3533
Enzymes [BR:plm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Plim_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4563067..4564344
Genome map
AA seq 425 aa AA seqDB search
MSVEFKLPQLAEGIDSADIAQILVSAGDTIEAGKIVMELETDKAVMELACPHAGKIGKIH
VKPGETIKTGQLLLSIEASGASNGTSAKPASPAASSSAPAAPAKATPAAPVKAAPAPAAV
AAPTRSTVEIPIAAGPATRRLARELGMQLERLRGTGPGGRITQEDVARAYAAQQGGGGGG
VVAPPLPDFSQYGPITAQALTKLQKTSANNLSAAWQLIPHVTQHDLADITETESARKRFQ
EAVAKGGPKVTMTAVAMKAAVAALKAFPNFNSSIDMSRGEVILKSYYNIGIAVDTPNGLV
VPVVRDVDKKSILQLATELTEIAEKARNRKLEIKDMQGGTFTITNLGGIGGTAFTPIVNY
PEVAILGMSRSFHQLQLVDGQVKERLMLPLSLSYDHRVVNGADAARFVVKLTSLLSDAFK
LLVEC
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgaattcaagctgcctcagttggcggaaggtatcgacagtgcagatatcgca
cagatcctggtctcggctggcgacacgatcgaagccggcaagatcgtcatggaactggag
accgataaggctgtcatggagctggcttgcccccatgcgggcaagatcggcaagatccac
gtcaaacctggcgaaacgatcaaaaccggtcagttacttctgagcatcgaagcctccgga
gccagtaacggaacatcggccaagcccgcttccccagccgcctcttccagtgctccagca
gcaccggcgaaggccactcctgctgcaccggttaaagccgcaccagcccctgctgccgtg
gctgcaccgactcgatcaactgtcgagattcccattgctgccggcccggccactcgccgc
ctggctcgtgaactgggcatgcagctcgaacgtctgcgtggcactggccccggtggtcgt
atcactcaggaagatgtggctcgcgcctacgctgcccagcaaggtggcggcggtggtggt
gtcgtcgctccgcctctccccgatttttctcagtatggcccgatcactgcccaggctctc
accaagctgcagaagaccagtgccaacaacctctcggcagcgtggcaactcattccgcat
gtgactcagcacgatctcgctgacatcaccgagactgaatcggcccgcaagcgattccag
gaagcagtggctaaaggtggccccaaagtcactatgacagcagtcgccatgaaggccgcc
gtcgctgctctcaaggccttcccgaacttcaattcgagcatcgatatgtctcgtggcgaa
gtgatcctcaagagctattacaacatcggtattgctgtcgatacccccaatggcctcgtc
gtgccggtggttcgcgatgtcgataagaagtcgattctgcaactggcgaccgagctgacc
gaaatcgccgagaaggcccgcaatcgcaagctcgaaatcaaggatatgcagggcggtact
tttactatcactaacctgggtggcattggcggaacggccttcacaccgattgtgaactac
cccgaagtggccattctcggcatgtcacgcagcttccatcagttgcaactggtcgatggg
caggtcaaagaacgcttgatgctgccactctcgctctcctacgatcaccgcgtggtcaac
ggggctgatgcggcccgctttgtcgtgaaactgaccagcctcctcagcgatgccttcaaa
ctactggtcgagtgctaa

DBGET integrated database retrieval system