KEGG   Planctopirus limnophila: Plim_3533Help
Entry
Plim_3533         CDS       T01225                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plm  Planctopirus limnophila
Pathway
plm00010  Glycolysis / Gluconeogenesis
plm00020  Citrate cycle (TCA cycle)
plm00620  Pyruvate metabolism
plm01100  Metabolic pathways
plm01110  Biosynthesis of secondary metabolites
plm01120  Microbial metabolism in diverse environments
plm01130  Biosynthesis of antibiotics
plm01200  Carbon metabolism
Module
plm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plim_3533
   00020 Citrate cycle (TCA cycle)
    Plim_3533
   00620 Pyruvate metabolism
    Plim_3533
Enzymes [BR:plm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Plim_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADG69346
UniProt: D5SV60
Position
4563067..4564344
Genome map
AA seq 425 aa AA seqDB search
MSVEFKLPQLAEGIDSADIAQILVSAGDTIEAGKIVMELETDKAVMELACPHAGKIGKIH
VKPGETIKTGQLLLSIEASGASNGTSAKPASPAASSSAPAAPAKATPAAPVKAAPAPAAV
AAPTRSTVEIPIAAGPATRRLARELGMQLERLRGTGPGGRITQEDVARAYAAQQGGGGGG
VVAPPLPDFSQYGPITAQALTKLQKTSANNLSAAWQLIPHVTQHDLADITETESARKRFQ
EAVAKGGPKVTMTAVAMKAAVAALKAFPNFNSSIDMSRGEVILKSYYNIGIAVDTPNGLV
VPVVRDVDKKSILQLATELTEIAEKARNRKLEIKDMQGGTFTITNLGGIGGTAFTPIVNY
PEVAILGMSRSFHQLQLVDGQVKERLMLPLSLSYDHRVVNGADAARFVVKLTSLLSDAFK
LLVEC
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgaattcaagctgcctcagttggcggaaggtatcgacagtgcagatatcgca
cagatcctggtctcggctggcgacacgatcgaagccggcaagatcgtcatggaactggag
accgataaggctgtcatggagctggcttgcccccatgcgggcaagatcggcaagatccac
gtcaaacctggcgaaacgatcaaaaccggtcagttacttctgagcatcgaagcctccgga
gccagtaacggaacatcggccaagcccgcttccccagccgcctcttccagtgctccagca
gcaccggcgaaggccactcctgctgcaccggttaaagccgcaccagcccctgctgccgtg
gctgcaccgactcgatcaactgtcgagattcccattgctgccggcccggccactcgccgc
ctggctcgtgaactgggcatgcagctcgaacgtctgcgtggcactggccccggtggtcgt
atcactcaggaagatgtggctcgcgcctacgctgcccagcaaggtggcggcggtggtggt
gtcgtcgctccgcctctccccgatttttctcagtatggcccgatcactgcccaggctctc
accaagctgcagaagaccagtgccaacaacctctcggcagcgtggcaactcattccgcat
gtgactcagcacgatctcgctgacatcaccgagactgaatcggcccgcaagcgattccag
gaagcagtggctaaaggtggccccaaagtcactatgacagcagtcgccatgaaggccgcc
gtcgctgctctcaaggccttcccgaacttcaattcgagcatcgatatgtctcgtggcgaa
gtgatcctcaagagctattacaacatcggtattgctgtcgatacccccaatggcctcgtc
gtgccggtggttcgcgatgtcgataagaagtcgattctgcaactggcgaccgagctgacc
gaaatcgccgagaaggcccgcaatcgcaagctcgaaatcaaggatatgcagggcggtact
tttactatcactaacctgggtggcattggcggaacggccttcacaccgattgtgaactac
cccgaagtggccattctcggcatgtcacgcagcttccatcagttgcaactggtcgatggg
caggtcaaagaacgcttgatgctgccactctcgctctcctacgatcaccgcgtggtcaac
ggggctgatgcggcccgctttgtcgtgaaactgaccagcctcctcagcgatgccttcaaa
ctactggtcgagtgctaa

DBGET integrated database retrieval system