KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: C548_138Help
Entry
C548_138          CDS       T02307                                 

Definition
Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plo  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C548_138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C548_138
   00020 Citrate cycle (TCA cycle)
    C548_138
   00620 Pyruvate metabolism
    C548_138
Enzymes [BR:plo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     C548_138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(158697..159809)
Genome map
AA seq 370 aa AA seqDB search
MIIKLPEIGDINKKVEVIEIPVKVGEFIKKDDTIVVLESEKATIDLPSPNEGTITKILIK
EGENIYSGKSIMELEDIINKKVILNKEKSIAQAGPAAKLMARKLGIDLETDKIIGSGKKN
CILKEDLKSYIKDKRIESSEDNTDQNVKNILSVSAKKLHNSWRNIPHVTHFDELDITKVE
KFRKTIKYELGIKITLLSFFIKVCSCALQKFSKFNMLLDLKTNKRNFHKSSHNNISIAIN
TSKGLLVPVIKHVDKKNIIDIALELKEITKRTLIGKNKLDDMMGGCFTISNLGIIGGKGF
TPIINSPEIGILGIGKTNIKPIWTGKQFKPTTMLPICLSYDHRFINGVYAAKFIKFIIKL
LTDIRNWIVC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaagctacctgaaataggtgatataaataaaaaagttgaagttatagaaata
cccgtaaaagtaggagaatttataaaaaaagatgacactatagttgttttagagtcagaa
aaagctactattgatttaccttcaccaaacgaaggaacaataactaaaattttaattaaa
gaaggtgaaaacatatattcgggtaagtcaataatggaattagaagacattataaacaaa
aaagttattttaaataaagaaaaaagtattgcacaggcgggtcctgctgcaaaattaatg
gcaagaaaattaggtattgatttagaaacagacaaaataatcggaagtggaaagaaaaat
tgtattttaaaagaagatttaaaaagttatataaaagataagagaatagagagttcagaa
gacaacactgatcaaaacgtaaagaatatattaagtgtaagtgctaaaaagttacataat
agttggagaaatatacctcatgtaactcattttgatgaattagatataacaaaagtagaa
aagtttagaaaaacaataaaatatgaattaggtattaaaataacattattatcttttttt
ataaaagtatgttcttgtgcattacaaaaattttctaagtttaatatgttgttggattta
aaaacaaataaacgtaattttcacaaatcaagccataataacattagcattgctataaat
acatcaaaaggtttgttagtgcccgtaataaaacatgttgataaaaaaaatatcattgat
attgctttagaattaaaagaaataactaaaagaacattaataggtaaaaataaactagat
gatatgatgggtggctgttttacaatatctaatttaggaataataggtggtaaaggtttt
actccaatcattaacagtccagaaataggaattttaggcattggcaaaacaaacattaaa
cctatttggactggtaaacaatttaaaccaacaacaatgttaccaatttgtctctcgtat
gatcatagatttataaatggcgtttatgcagcaaagtttattaaatttataattaagtta
ttaactgatattcgtaattggattgtttgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system