KEGG   Candidatus Portiera aleyrodidarum BT-QVLC: C548_282Help
Entry
C548_282          CDS       T02307                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
plo  Candidatus Portiera aleyrodidarum BT-QVLC
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:plo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C548_282
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C548_282
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C548_282
Enzymes [BR:plo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     C548_282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344186..345571
Genome map
AA seq 461 aa AA seqDB search
MRYVSTRGVAPVLSFEDTVLTGLASDGGLYVPEIIPKLSHKEFIELSKCSYIESAYRIMR
LFIDDVDDMSLKLLIKKSYTRFCNDSIVPIKQIGNNQFLLDLFTGPTFAFKDIALQFMGN
LIDYFLKKRGEKAVIMGATSGDTGSAAIAGFCDCNNLDMFILHPNKMVSEIQRRQMTTVK
QDNIHNIALKGNFDDAQAIVKDSFNNRGFIKGRRLIAINSINWARILAQTVYYIVSALAV
GAPFRNVSFTVPSANFGNIFAGYIAYKMGLPIRQLIIATNVNNILHRIIEYNDFSIRNLV
NTIAPAMDIVVSSNFERLLFYAYNKDSNAINNLIYNFNNKNYTILDEKPLKKLRTLFYST
SVNDNTILSILSQFYNRNGFIVDPHTAIGLIAAERCNNFPEIPMITLATAHPAKFYDTIL
KSGLFLKLPSLLNELLLKEEQYSILPADISKVHSYILSVCH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgttagtactcgcggtgttgctcctgtactttcatttgaagatacagtattg
actggtttagcaagtgatggtggtttatatgttccagaaataattcctaaactttcgcat
aaagaatttatcgaattaagtaagtgttcatatattgaatcagcatatcgtataatgcgt
ctttttattgatgatgttgatgatatgtccttaaaacttttaattaaaaaaagctataca
aggttttgtaatgattcaatagttccaataaaacaaataggtaacaatcaatttttattg
gacttgtttactggtcctacatttgcttttaaggatatagctttacaatttatgggtaat
ttaatagattattttttaaaaaaacgtggcgaaaaagctgttattatgggtgcaacgtca
ggagatacaggatcagctgctattgctggtttttgtgattgtaataatttagacatgttt
attttacacccaaataaaatggtatcagaaattcaaagaagacaaatgactacagttaaa
caagataatatacataatatagctttaaaaggaaattttgatgatgcgcaggcaatagtt
aaagatagttttaataatcgtggctttattaaaggaagaaggttaattgctataaactca
ataaattgggcacgtattttagcacaaacagtatattatattgtttcagcacttgcagta
ggtgctccttttaggaatgtaagttttaccgtaccgtcagcaaattttggaaatattttt
gcaggatatatagcttataaaatgggcttgccaattaggcaactaataattgcaacaaat
gttaataatatacttcatcgtattatagaatataatgatttttctataagaaatttagtt
aatactatagcgccagctatggatatagttgtttcttctaattttgaacggttgttgttt
tatgcttataataaagattcaaatgctattaacaatttgatttataactttaataataaa
aattacactatactagacgaaaaacctttgaagaaattaagaactttgttttatagtacg
agtgtaaatgataacactattttgtctatactaagtcagttttataaccgtaatggtttt
atagtagaccctcacacagctataggtttaattgctgccgaaagatgtaataattttcca
gaaatacccatgattacgttagctacagctcatccagctaaattttatgataccatttta
aaatctggactttttcttaaattaccttctttacttaacgaattattactaaaagaagaa
caatattctattttgcctgcagatatttcaaaagtgcacagttatatattaagtgtttgt
cattaa

DBGET integrated database retrieval system