KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0005Help
Entry
Ple7327_0005      CDS       T02367                                 

Definition
putative bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:plp00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:plp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4550..6976)
Genome map
AA seq 808 aa AA seqDB search
MQYQISLPEIPPCAWKRPIGLGWDKPYTVRYASNLDDGPWHGMPLGGFGAGCIGRSSRGD
FNLWHLDGGEHVFRSLPACQFSVFEQPEGGEAQAYAMCTEPPEDGTLSRWLWYPKKKGTY
HALYPRSWYEYKGVFQSELVCEQFSPICAGNYQETSYPVAIFEWTAHNPTDKPITLSIML
TWQNTVGWFSNAIKSPSIQVRDDGSPEYEYQPRWGDSTGNFNQWIVDNFRVGCLLNRIRL
HEDEIGEGEGQICFASITNPTIEASYLGRWNPNGDGSEVWDCFAANGSLPDTEDETPAEP
GEQIAAAMAIRFTVRPGKTRKIPFILAWDLPITEFAEGVKYCRRYTDFFGRTGTNAWAIV
RTALKHGDMWKERIKEWQSPILKREDLPDWFKMALFNELYLLADGGTLWTAATEDDPIGQ
FGVLECMDYRWYESLDVRLYGSFGLMMLWSRLDKAVLEAFARAIPTGDDTPRIIGYNKAP
AIRKAKGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLQVYRDFVLTGAKDVAF
LWECWQSIVETLAYLKKFDRDGDGIPENSGAPDQTFDDWRLRGISAYCGGLWIAALEAAI
AIGKILIENPPSNPDLELENYPQSLQNTIQTYQNWLQGARSLYHEKLWNGEYYHLDSESG
SDIVMADQLCGQFYARLLGLPDVVERQYAESALKKVYEACFLKFQDGKFGAANGVKPDGS
PEDPKATHPLEVWTGINFGLAAFLLQMGMKDEAFKLAETVVRQVYDNGLQFRTPEAITAV
GTFRASHYLRAMAIWGIYGVLTEFKEVK
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcaaatctcactcccagaaattcctccttgcgcctggaaacgtcccatcggt
ttaggttgggacaagccctacaccgttcgctacgctagcaatctcgacgatggtccttgg
catggaatgcctttgggcggattcggtgcggggtgtatcggtcgttctagtcgaggcgac
tttaacctctggcacctcgacggcggcgaacacgtttttcgctcccttcctgcctgtcaa
ttcagcgtctttgaacaaccagaaggcggagaggcgcaagcttatgccatgtgtaccgaa
ccgccagaggacgggactttatctcgatggttatggtatccgaagaaaaaaggaacttac
cacgccctctacccccgcagctggtacgaatataagggagtttttcaatcggaactcgtt
tgcgagcagttttctcccatttgtgcgggcaattatcaggaaacaagctatcctgttgct
atttttgaatggacggcacacaacccaaccgataaacccattaccctcagtattatgctg
acttggcagaatacagtcggttggttttccaatgccattaagtctcccagcatacaagta
cgagatgatggcagtcccgaatatgaataccaaccccgttggggcgacagtacggggaat
ttcaatcagtggattgtcgataattttcgcgttggttgcttgctcaaccgcatccgactc
catgaagacgagattggagagggagaaggacaaatctgttttgccagcattaccaatccc
acgatagaagcttcctatctcggtcgctggaatcctaacggtgatggttccgaggtctgg
gattgctttgccgcgaacgggtctttacccgacacagaagacgaaacgcctgccgaaccg
ggagagcaaattgctgctgctatggcaattcgctttaccgttcgtcccggcaaaactcgc
aagattccctttattttggcgtgggatttgccgattacagaatttgccgaaggggtgaaa
tattgtcgccgctacaccgatttttttgggcgcacgggaactaatgcttgggcaatagtt
cgtactgccctcaagcacggagatatgtggaaggaacggattaaagagtggcagtcgccg
attctcaaacgcgaggatttgccagattggttcaaaatggcgctgtttaacgagctatat
ttgcttgccgacggcggaactttatggacggcggcaaccgaagatgatcctatcggacag
tttggggtacttgaatgcatggactaccgctggtacgaaagtctggacgtacgcttgtac
ggatcgtttggactgatgatgctttggtcgcgcttagataaagcggtgttggaggcgttt
gctagggcaattccgacgggagacgatacgcctcgaattattggatataataaagcgcca
gcaatacgtaaggctaagggggcaacgccgcacgacttgggcgcaccgaacgaacatcct
tgggaaaagactaattacactagctatcaagattgcaatctttggaaggatttaggtagc
gattttgttttgcaggtgtatcgggatttcgtgctaacgggagcgaaagatgttgctttt
ttgtgggaatgttggcaatcaatcgtagaaaccctcgcttatttaaaaaaattcgatcgc
gatggcgatggcattcccgaaaattctggcgcacccgatcaaaccttcgacgattggcgg
ttgcgggggattagtgcttattgcggcggattgtggatagcggcactagaagctgcgatc
gctataggcaaaattttaatcgaaaatccgcccagcaatcccgatctagagctagaaaat
tacccgcaatcgctccaaaataccattcaaacctatcaaaattggttgcaaggagcgcga
tcgctctatcacgaaaaactctggaatggagaatattatcatctcgacagcgaaagtggt
tcggatattgtcatggcagatcaactatgcggccaattttatgcccgtctgttaggattg
ccagatgtcgtagaacggcaatatgccgaatctgccttgaaaaaagtctatgaagcttgt
tttttaaagtttcaagacggtaaattcggggcggcaaatggagtcaaacccgatggttcg
ccagaagatcctaaagccacccatccgctagaagtttggacgggaattaattttgggttg
gctgcatttctgttgcaaatgggaatgaaagatgaggcatttaagctcgcagaaactgtc
gtgcgacaagtgtacgacaatgggctgcaattccgcacgcccgaagcgattacagcagta
ggaacctttcgagcgagtcattatttacgcgctatggcgatttggggaatttatggcgtt
ttgaccgagtttaaagaggtcaaataa

DBGET integrated database retrieval system