KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0042Help
Entry
Ple7327_0042      CDS       T02367                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ple7327_0042
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Ple7327_0042
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ple7327_0042
Enzymes [BR:plp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ple7327_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(47897..49504)
Genome map
AA seq 535 aa AA seqDB search
MSGFFKMNNPFFNRFLSTQLKRRNLLLGAGVLGGLAIANRSRYLIAQPKYSDYPFSLGVA
SGEPDSNSVVLWTRLAPNPRRGNTLPSADIPLQWQVATDEKMRRVVAKGVVLATPEWAHS
VRVVVEGLESDRWYWYQFRTGNEVSPVGRTRTCPAPTASSKRLSFAFASCQNYEHGYFNA
YRHMSEEEIDFVIHLGDYIYEGGGVPRPDNVRSHGSPEPMDLEGYRRHYALYRSDRDLQE
AHRLFPFICTWDDHEVDNDYANLESQDFDEIAAFAKRRAAAYQAYYEHLPFRPASRPQGD
RMQLYRRFSWGNLALFHILDTRQYRDDQACDENGDGGGQVVECQERLAEARSLLGQPQEQ
WLLDGLTNSSAHWNIIAQQYLVAQLKQQKDGREGYWSDGWDGYAANRKRILDHIAQQRPS
NPIFIGGDIHSFWVSELKSDFQNPASPTVACEFVGTSISSNGVPYDQFASVLPENPHIKF
FESRLRGYVKCAVSRQEWRSDLRVVDTVKQQNSKVSTLATFVVEDGNPQVRQLEP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttttttaagatgaataacccgttcttcaatcgtttcctatctacccagctg
aaacgacgcaacctcttgctaggggccggcgttctgggaggtttagccatcgccaatcga
tcgcgctatcttattgcccagcccaagtattccgattatcccttcagtttgggcgttgcg
tctggagaacccgattctaatagcgtcgtcctctggacgcgactcgcaccgaatccccgc
cggggaaataccctgccatcggcagacattcccctgcaatggcaagtggcaaccgatgaa
aaaatgcgtcgcgtcgtcgccaaaggcgtggtcttggcaactcccgaatgggcgcactcg
gttcgcgtcgttgtagaaggactggaaagcgatcgctggtactggtatcagtttagaaca
gggaacgaagttagccctgtcggtcgtacccgcacttgccccgcaccgacagcttcaagc
aaacgtctgtcttttgcctttgcttcttgtcaaaattacgaacacggctattttaatgcc
tatcgtcacatgagcgaggaggaaatcgattttgttattcatctgggcgactatatttac
gaaggtggaggcgtgcctcgcccggataatgtaagaagccatgggagtcccgaaccgatg
gatttagaggggtatcggcggcattacgccctctatagaagcgatcgcgatctccaagaa
gcccatcgattatttccttttatttgcacctgggacgaccacgaagtcgataatgactat
gccaacttggaatcgcaagattttgatgaaatagcagcgttcgccaaacgtcgcgcggca
gcttaccaagcttactacgaacatttgcccttccgtcccgcttctcgtcctcaaggcgat
cgcatgcaactctatcgacgttttagctggggcaatctagcattgtttcacattttggat
acgcgacagtatcgagacgaccaagcctgcgacgagaatggcgatggtggcggtcaggtt
gtagagtgtcaagaaagattagccgaagcgcgatcacttctcggtcaacctcaagaacaa
tggttgctcgatggtttaaccaattcatccgcccattggaatattattgcccaacaatat
ctagtcgcgcaactcaagcagcaaaaagacggtcgagaaggttactggagcgacggttgg
gatggctatgcagcaaatcgaaagcggattctcgaccatattgcccaacagcgcccgtcc
aatccgatttttatcggcggcgacatccattcgttttgggttagcgaactcaagtcggac
tttcaaaatcccgcctctcctacagtcgcctgcgagttcgtcggtacgtcgattagttca
aatggcgttccctacgaccaatttgcgtctgttttgccggagaatcctcatattaagttt
tttgaaagtcggttgcgaggttacgttaaatgtgctgtatcgcgtcaggagtggcgcagc
gacttgcgggtggtagatacggtcaagcagcaaaatagtaaagttagcacgctggcgaca
ttcgtagtggaggatgggaaccctcaagttcggcagttagagccttga

DBGET integrated database retrieval system