KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0152Help
Entry
Ple7327_0152      CDS       T02367                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:plp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ple7327_0152
DNA repair and recombination proteins [BR:plp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ple7327_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164398..164991)
Genome map
AA seq 197 aa AA seqDB search
MYTPPLARLIEQLQRLPGVGPKTAQRLALHILKRSEAEVQALASAIIEAKKQVGLCQVCF
HLSAEPICEICRNPNRDSSTICVVADSRDVIAIEKTREYSGKYHVLGGVISPMDGIGPEQ
LNITPLVQRVDREKVKEIILAISPSVEGETTTLYVGQLLRPFTKVTRIAFGLPMGGDLEY
ADEVTLARALEGRRELD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atttatacacctcccttagctcgtctgatcgaacaactgcaacgtttgcccggtgtagga
ccaaaaaccgcccagcgattggcactgcatattctcaagcgctccgaagccgaagtgcaa
gcattagctagcgctataatcgaggcaaaaaagcaagtcggcttgtgtcaagtttgcttt
catctctcagccgaacccatctgcgaaatctgccgcaatcccaatcgggacagtagcact
atctgcgtagtggcagactctcgcgacgtgattgccatcgaaaaaacgcgagagtatagc
ggcaagtatcacgtgctaggaggagtcatctctccaatggacggcatcggtcccgaacag
cttaatattacccctttggtgcagcgagtcgatcgcgagaaagtaaaagaaatcattttg
gcaattagcccaagcgttgagggagagacgacaaccctttatgtcggtcagcttcttaga
ccattcacgaaagtcacgagaattgcctttggtttgcctatggggggcgatttagaatat
gccgatgaagttactctggcaagagccttagaaggaaggcgagaactggattag

DBGET integrated database retrieval system