KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0265Help
Entry
Ple7327_0265      CDS       T02367                                 

Definition
(GenBank) fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp01040  Biosynthesis of unsaturated fatty acids
plp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ple7327_0265
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ple7327_0265
Lipid biosynthesis proteins [BR:plp01004]
 Desaturase
  First
   Ple7327_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Flp_Fap
Motif
Other DBs
NCBI-ProteinID: AFY75733
UniProt: K9SZW2
Position
complement(300138..301112)
Genome map
AA seq 324 aa AA seqDB search
MEVQNLESTKARQAMGTKGLSSRDRVRVTNDYFQKIYRRLSLITVLIPFIGTVFAIALLW
YVPITAVEVGLLVGMYALTILGVEVGFHRLFSHRAFRTTTPVRVALAIFGSMAAQGGVMF
WVAHHRCHHQYTDLPNDPHSPHLHGEGIRGRLRGLWHSHLGWVLKGEIPNSMLFAKDLLR
DPAIAKVNQWQQYWVLLGLVIPAVIDGLISRTWMGVLLGFLWGGLVRVFLGQQVINATNS
ICHIYGGRPFNSDDRSTNNLWLAIPSFGQSLHNNHHAFPSSAIVGLKWWQIDLGNWVVWM
LKATGLAWNVKMPSASQIEAKRAV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcaaaaccttgaatctacgaaagctcgtcaagcgatgggaaccaaaggtttg
tcaagccgagatcgcgtcagggtaacaaacgattatttccaaaaaatctatcggcgattg
agcttgattactgtcttgattccctttatcgggacggttttcgcgatcgcactgctgtgg
tacgttcccattacagcggtagaagtaggattattggtcggcatgtatgcactgaccatc
ctgggagttgaggtgggtttccatcgactcttttcgcaccgcgcttttaggacgacgact
cccgtccgcgttgctctcgccatcttcggttcgatggcagcacagggaggagtgatgttt
tgggtagcacaccatcgctgtcaccaccagtacaccgatctccccaacgatccccattcg
ccccacctgcatggggaaggcattcgaggacgactgcgcgggctgtggcactctcactta
ggctgggttctcaaaggcgaaattcccaactcgatgctgtttgccaaagatctgctgcgc
gatccggcgatcgctaaagtcaaccagtggcagcagtactgggtacttctcggtcttgtc
atccctgctgtcatagatgggctgatctcccgaacctggatgggagttttactagggttt
ctctggggaggactcgtgcgcgttttcctgggacagcaagttatcaacgctaccaactcc
atctgtcacatatatggcggtcgtcccttcaactccgacgatcgcagcaccaacaacctt
tggcttgcgattccctccttcggacagtcgttgcacaacaaccatcacgcttttcccagt
tcggcgattgtcgggctgaagtggtggcagatcgatctgggtaactgggttgtttggatg
ctgaaggcgacaggcttagcttggaacgtgaaaatgccatcggcgagccaaatagaagcc
aagagagcagtttag

DBGET integrated database retrieval system