KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0281Help
Entry
Ple7327_0281      CDS       T02367                                 

Definition
(GenBank) magnesium chelatase ATPase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00860  Porphyrin and chlorophyll metabolism
plp01100  Metabolic pathways
plp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ple7327_0281
Enzymes [BR:plp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ple7327_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA Sigma54_activat AAA_5 MCM VWA_3 VWA_CoxE DUF3391 PAXIP1_C Adeno_terminal
Motif
Other DBs
NCBI-ProteinID: AFY75748
UniProt: K9SZX7
Position
322368..324374
Genome map
AA seq 668 aa AA seqDB search
MPALTTSRTSLSFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVLARGIHAL
LPPIEVIKGSPFNCDPANPDEWDDKTQQLYGNAAEIPTEVIPAPFVQIPLGVTEDRLLGS
VDVEESVKRGEPIFQPGLLAEAHRGVLYVDEINLLDDQIANQLLTVLSEGRNQIEREGIS
FQHPCKPILIATYNPEEGALREHLLDRIAIALSADGVLNLDQRVEAINHAIAYANSPQAF
IEQYAGEIDDLKTEIILAREWLKDVKISRDQIAYLVEEAIRGGVEGHRAEIFAVRVAKAA
AALEGRDRVTAEDLRRAVEFVIVPRATLLQPPPEEAPPPPPPPQEQPKDESQQDQEEREE
ENPEEPEQEPPGIPEEFVFDPEGVVLDPAVLYFAQMAQRQGKSGSRSLIFSEDRGRYIKP
MLPKGKVKRIAVDATLRAAAPYQKARRLRHRDRKVIIEEGDIRSKRLARKAGALIVFVVD
ASGSMALNRMQSAKGAVLRLLAEAYENRDQVALIPFRGERAEVLLPPTRSIALARRRLET
LPCGGGSPLAHGLTQAVHVGMNAKLSGDIGQVVIVAITDGRGNIPLARSLGEPLPEGEKP
DIKGELLEIAAKLRALGMKLLVIDTESKFVSTGFAKEIALKAGGKYYHLPKANERAIAQM
AKGAIASL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctaacaacttctcgcactagcctgagctttcctttaactgccgttgtcgga
caagaagccatcaaactcgctctgctattggctgccgtcgatccgggattgggaggggtg
gcgatcgcgggtcgtcgggggacggcaaaatcggtattagcacggggaattcacgcccta
ctgccgccgattgaagtcattaaaggcagcccttttaattgcgatccggctaacccggac
gaatgggacgacaaaacgcagcaattgtatgggaatgcggcagaaattcctactgaagtc
attcctgcgcctttcgtacaaattcctttaggcgtgacagaagatcgactgttgggatcg
gtagatgtggaagagtcggtcaaacgaggggaacccatctttcaacccggattgctggca
gaggcgcaccgaggcgtgttgtacgtcgatgagattaacttgctcgacgaccaaattgcc
aatcaactgctaaccgttttaagcgaagggcgcaatcagatcgaacgggaagggattagc
tttcagcatccatgcaaacctatcttaattgccacctacaatccagaagaaggggcgctg
cgagagcatttactcgatcgcatcgcgatcgcgctttcggcggatggcgtgttaaattta
gaccagcgagtggaagccattaatcacgcgatcgcctacgccaattctccccaagctttt
atcgagcagtatgctggcgagatagacgaccttaaaaccgagattattctggcgcgggaa
tggttgaaagatgtcaagattagccgcgaccagattgcctatctcgttgaagaagccatt
cgcggcggggtagaaggacatcgggcggaaatttttgccgtgcgagttgccaaagccgcc
gccgccctagaaggacgcgatcgcgttacggcagaagacttgcgaagggcagtagaattc
gttatcgtgcccagggcaactctactgcaaccgccaccggaagaggctcccccaccgcct
ccaccgcctcaagaacagcccaaagacgaatcgcaacaagaccaagaggagcgagaagag
gaaaacccagaagaacccgaacaagaacccccaggcatcccagaggaattcgttttcgat
cccgaaggagtcgttctcgatcccgccgtgctttacttcgcgcagatggcgcagcgacaa
gggaaatcgggaagccgcagcttgattttttcggaggatcgagggcgctatatcaagccg
atgctgcccaagggcaaggtcaaacgcatcgcggtagatgccaccctgcgggcggctgcc
ccctaccaaaaagcccgccgcttgcgccatcgggatcgcaaggtgattatagaagaaggg
gatatccggtcaaagcgactcgccagaaaagcgggggcattgatcgtatttgtggtggat
gcttccggttcgatggccctcaatcgcatgcagtcggcaaaaggcgcagttttgcgattg
cttgctgaagcatacgagaatcgcgaccaagttgccttgattcccttccgaggcgaaagg
gcagaggtcttgttgccgccgactcgttcgattgctttagcgcgacggcgcttagaaacc
ttgccctgtggcggaggttctcctttagcccacggtttgacgcaggcggtacacgtgggg
atgaatgccaagttgtctggcgatatcggtcaagtggtcatcgtggcgattactgacgga
cgaggaaatattcccttggcgagatcgctgggcgaacccttacctgaaggagaaaagcca
gatatcaagggagagttgttagaaattgctgccaagcttcgtgccctggggatgaagctg
ttagtcatcgatacggaaagcaagttcgtatcgactggatttgccaaggagatagcactc
aaagcaggtggcaaatattatcacctgcctaaagccaacgaacgcgcgatcgcgcagatg
gctaaaggcgcgatcgcgtctctataa

DBGET integrated database retrieval system