KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0290Help
Entry
Ple7327_0290      CDS       T02367                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ple7327_0290
Enzymes [BR:plp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ple7327_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(332764..333681)
Genome map
AA seq 305 aa AA seqDB search
MLLQSTPAVRQFLGLEATSTYEAAKVVILPIPYEATTTFRKGCEKGPDALLEASDQLEAY
DEELKRETCIEVGIYTHPAIADTRQNPDLCADEMLAVTTETVSRFIADNKFVIAVGGEHA
ITTGIIRAYQQAINDPFSFTVVQIDAHGDMRHEYEGSLHNHACVMRRVLEMGLPTLSVGI
RSICQEEALLIEEKQIPVVWARDIANNPNWIEDAIAQISTPKVFITIDVDGIDPSLIPGV
GTPEPGGLDWYGITKFMRRVFETHQVIGCDIMELAPIVDSVVSEYTTAKLLYKLIGYQAL
TQGWF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctcttacaatctactccagccgtaaggcaatttcttggcttggaagccacatcgact
tacgaagctgccaaagtcgtgattttgcctattccctacgaagccaccaccacctttcgc
aaaggttgtgaaaaaggtcccgatgccttgctagaagcatccgaccaactagaagcctat
gatgaagaactaaaacgggaaacctgtatcgaagttgggatttacacccaccccgccatc
gccgatacgcgccaaaatcccgatctttgtgctgacgaaatgctagcagtcactaccgaa
actgtctctcgcttcattgccgacaataaatttgttattgctgtaggcggcgaacatgcg
attacgactggaatcatcagggcgtaccagcaagcgataaacgatcccttttcctttacc
gtcgtacaaatcgatgctcacggggatatgcgccacgaatacgaaggttccttgcacaat
catgcttgcgtaatgcgccgggttttagagatgggattgccaacgctgtcggtcggcatc
cgcagtatttgtcaagaagaagcgttattaatcgaagaaaaacaaattcccgtcgtttgg
gcgagagatatcgctaacaatccgaattggatagaagacgcgatcgcgcagatatcaacc
cctaaagttttcattaccatcgatgtagatgggatcgaccccagtctaatccccggcgta
ggaaccccagaacctggaggcttggattggtatggcatcactaaatttatgaggcgagtg
tttgaaacccatcaggttatcggttgtgacatcatggaattagcccccatcgtcgattcc
gtcgtttccgagtataccactgccaaattgctttataaattaatcggttatcaagcactt
actcaaggatggttttag

DBGET integrated database retrieval system