KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0603Help
Entry
Ple7327_0603      CDS       T02367                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:plp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:plp00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:plp00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:plp00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646331..647617)
Genome map
AA seq 428 aa AA seqDB search
MDLLEYQAKELFHQIGIPILPSQTIADPSELKRLQIRYPVVLKSQVRAGGRGRAGGIRFV
ENTIDAIAAARTIFNLPIMGEYPEVILAEARYDAQQEFFLAVLLDYQLKRPVLLGSTRGG
IDLDTLLEHMQKVVIDEEFSPFYARRLAIKMGLRGALIQSVSAIIEKIYHLFSEKDLDLV
EINPLGVSADGELMALDGKITVNDSAIKRHLDIERLTVSKKQASQKPSSELEVPSSTVEI
PEPRWLDRIDEKGNIGILSNSLGLAMATWDLIVQDKGKPACCLIVGEATNGKCLPDGTLT
QELGEAIELALEVKGLKVVLVNLLGSAEAIEMLGQALADYLQPHIGQTAERTSEERAPRA
TSAVSPRRLRSLQSRSGKSQANEPPQFVIRLGTGEIASVKERLTTMPVFLTDDLDDAIAQ
TLSIAKSK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggatttactcgaatatcaagccaaagaattatttcatcagatcggcattcccattttg
ccatcgcaaacgatcgccgaccccagcgaactgaaacggttgcaaattcgctatccagtc
gttctcaaatcccaggttcgagcaggaggcaggggaagggcaggcggtatccgcttcgta
gaaaatacgatcgacgcgatcgcggcagcgcgaaccatttttaatttgcctattatggga
gaataccccgaagtcatcctggcagaagctcgctacgatgcccaacaggaattttttctg
gccgtgttgctcgactatcagctaaaacgccccgtattgctcggttcgaccaggggagga
atcgatctcgacaccttactggagcacatgcaaaaagtcgttatcgacgaagaattttcc
ccattctacgcgcggcggttggcgattaaaatgggactccgaggcgcgttaatccagtct
gtcagcgcgattatcgagaagatttaccatctctttagcgaaaaagatttggatctggta
gagataaatccgctaggagtcagtgctgacggggaactcatggctctcgatggcaaaatt
accgtcaatgatagtgccatcaaacgccatttagatatcgaaaggctgactgtctcgaaa
aaacaggcttcccaaaagccttctagcgaattggaagtgccttcatctacagttgagatc
ccagaacctcgatggctagatcggatcgacgaaaagggaaatatcgggattctctccaat
agcttggggctagccatggcaacttgggatttaatcgttcaagataaaggcaaacccgct
tgctgcctaatcgtgggcgaggcaaccaacggcaaatgtctgcccgatggaactttaact
caagaattaggagaggcaatagagctggcattagaggtaaaaggactcaaagtggtgtta
gtaaatctgttaggcagtgccgaagcaatagaaatgttaggacaagcgctcgccgattat
ttacaaccgcacatcggacaaaccgcagagcggacgagcgaagagagagcgccaagagcc
acaagcgcagtgtctccaagacgattgcggagccttcagtcgcgttcgggcaagtcacaa
gcgaacgaaccccctcaatttgtcatccgccttggcacaggagagatcgcatcggttaaa
gaacgcctaactactatgcccgtcttcttgacagatgacttagatgacgcgatcgcgcag
acgctctccatagccaaatcgaaataa

DBGET integrated database retrieval system