KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0606Help
Entry
Ple7327_0606      CDS       T02367                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
plp  Pleurocapsa sp. PCC 7327
Brite
Enzymes [BR:plp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Ple7327_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650645..651811
Genome map
AA seq 388 aa AA seqDB search
MSIRRLATRRNFLLGLGTLAGASIAVAGKSTSTYVKNLIHTSRYESRDFATVGNAPLRDR
AAAKGLIYGAVGDYLPLSSDKNYATSFARECGMLVSGELKWYFIRPTPDSFDFTKSDWVA
KFARVSSMHFRGHTLVWHISLPDWFEETVNRQNAEGFLVEHIKTVVGHYAGQIHSWDVLN
EAIEPNDGRPDSLRKTPWLEFLGEDYLDLVFRVAAETDPQALLVYNDFGMDYDNPRDEAR
RIAILKLLERLKSKGTPVHALGIQAHLWADATDFNPKKLRDFLSQVASLGLKILITELDV
ADHRLPPDIKLRDRVVAGVYEDYLSTVLDEPAVIAIITWGLSDRYSWMPEYHPRPDGLPL
RPHPLDKHFKPKLAWNAMARAFDRAPQR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctattagacgactggcaacgaggcgaaactttctcttgggtcttggtaccttggca
ggagcgagcattgcagtagcgggaaaatctacctctacatacgtgaagaacctgattcat
acgagtcgatatgagtcgagagactttgcaacggttggaaatgcccctctgcgcgatcgc
gcggcggctaaaggcttaatttacggcgcggtaggagattatttgccgctgtcgtctgat
aaaaactatgcaaccagttttgcgcgagagtgtggcatgctcgtatcgggggaactgaaa
tggtatttcatccgtcccacgcccgatagttttgattttactaaaagcgattgggtcgct
aaatttgctcgtgttagtagcatgcattttcgcggtcataccctagtctggcatatttcc
ttgcccgactggtttgaagagacagttaaccgtcaaaatgccgagggatttttagtcgag
cacattaaaacggtagtcggacattatgccggacaaatacattcctgggacgtactcaac
gaagcgatcgaacccaacgacggacgacccgacagtttgcgcaaaacgccatggctggaa
tttctaggcgaagattacctcgatctggtcttccgcgtcgctgccgaaaccgacccacaa
gcactcttagtctataacgattttgggatggactacgacaatcccagagatgaggcgagg
agaattgctattttgaagctattagagcgtttaaaatcgaaaggaacgccagtccatgcc
ctagggattcaagctcatctgtgggctgatgcaacggattttaaccccaaaaaactgcgc
gatttcttaagtcaggtcgccagtctgggtttgaaaatcttgattacagaactagacgta
gcagaccacagattgcccccagatataaagctgcgcgatcgcgtcgttgctggagtctat
gaagattatctctcaaccgtactcgacgagccagccgttattgccattatcacatgggga
ttgagcgatcgctatagctggatgcctgaatatcaccctcgcccggatggtctccccttg
cgtccccatcccttggacaaacacttcaaacccaaactagcatggaatgccatggctcgt
gctttcgatcgcgccccgcagcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system