KEGG   Pleurocapsa sp. PCC 7327: Ple7327_0642Help
Entry
Ple7327_0642      CDS       T02367                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Ple7327_0642
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Ple7327_0642
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Ple7327_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(684998..685552)
Genome map
AA seq 184 aa AA seqDB search
MAILRLESGTTYTQLEDISRELAPLNVQLNYWSVGDNPELRKLLAQEKLNEDEKKQVLQA
LDGYFERLKQNAGYQSRDLIVLHPNIPNLDALLAKFESCHTHADDEVRYIIDGEGVFGFV
RPDGSQVELTIQPEEYINVPAGTEHWFHLSDRKRIKAVRYFVTTEGWVPKYTGTSIRFPA
LAMG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcaattttacgtttggaaagcggaacgacctacacccaattggaagacatttcccgc
gaacttgctcccctcaacgttcagctcaattattggtctgtcggcgataatcctgaactt
cgtaagttgctagcacaagaaaaattaaatgaagacgaaaaaaaacaagttttacaagca
ttagacggctattttgaacggttaaagcaaaatgcaggctatcaatctcgcgatttaatc
gttctccatcccaatattcccaatttagatgctttgctggctaaatttgaaagctgccat
acccatgcagatgatgaagtgcgttatatcatcgatggcgagggagtttttggattcgtt
cgtcccgacggatctcaggtagaactaaccattcaacccgaagaatatatcaatgtcccc
gccggaacggaacattggttccatcttagcgatcgcaaacgcattaaagcagtccgttac
tttgtcactacagaaggttgggttcctaaatacacgggaacctcaattcgtttcccagct
ttagcaatgggttag

DBGET integrated database retrieval system