KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1178Help
Entry
Ple7327_1178      CDS       T02367                                 

Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ple7327_1178
Enzymes [BR:plp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ple7327_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249430..1250509)
Genome map
AA seq 359 aa AA seqDB search
MTATLQAPPKTRRVIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVADDPFNSDPYDPDLMSDRVREQLEKQIPLQIVKKKVPMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDSNP
QKFCEKYQPEQEALQEKIINAQKLLPQVEIDYDLRIKISEVCSALDVDGLRGDIVTNRAA
KALAAFEGRTTVTVDDIRRVITLALRHRLRKDPLESIESGYKVEKAFNRVFGLEVSEEN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccctccaagcacctccaaagactcgtcgcgtaattttccccttcaccgcg
attgtaggtcaagaagaaatgaaactcgctctcatcctcaatgtaatcgatccgaaaatt
ggcggggtaatgattatgggcgatcgcggcactggcaaatcgacgacaattcgggcctta
gccgatttattgccagaaattgaagtcgtcgccgacgatcccttcaattccgatccctac
gatcccgatctaatgagcgatcgcgttcgggagcaactagagaaacaaattcccctacaa
attgtcaaaaagaaagttcccatggttgacttgcctctaggagccactgaagatagagtt
tgcggcacgatcgacattgaaaaagccctctccgaaggggtgaaagcctttgaacccgga
ctgctggcaaaagctaatcgaggcattctctacgtcgatgaagtcaacttgctcgacgat
cacctcgtagacgttttattggattctgccgctagcggttggaataccgtcgaacgagaa
ggaatttccattcgccaccccgcccgtttcgtgctggtaggttccggcaacccagaagaa
ggagaattgcgacctcagttgctcgatcgctttggcatgcacgccgaaattcacaccgtc
aaagaacccgcgctgagagtgcaaatcgtcgagcagcgctccgaatttgacagcaatccc
caaaaattctgcgaaaaataccaacccgaacaagaagcgctgcaagagaagattattaac
gctcaaaaacttctgccccaagtcgaaatcgattacgatttgcgcattaaaatttccgaa
gtttgttccgctctcgatgtcgatggcttgagaggagatatcgtcaccaatcgcgccgct
aaagccctagcagcctttgaagggcgcacgaccgtgacggtagacgatattcgtcgggta
attaccttggctctgcggcaccgactgcgcaaagaccccctggagtcgatcgaatccggc
tataaagtcgaaaaagccttcaatcgggtattcggtttggaagtgtcagaagaaaactag

DBGET integrated database retrieval system