KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1178Help
Entry
Ple7327_1178      CDS       T02367                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00860  Porphyrin and chlorophyll metabolism
plp01100  Metabolic pathways
plp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ple7327_1178
Enzymes [BR:plp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ple7327_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat AAA_29 AAA DUF815 AAA_18 ABC_tran AAA_28 AAA_30 AAA_7 AAA_27 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFY76581
UniProt: K9T346
Position
complement(1249430..1250509)
Genome map
AA seq 359 aa AA seqDB search
MTATLQAPPKTRRVIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVADDPFNSDPYDPDLMSDRVREQLEKQIPLQIVKKKVPMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDSNP
QKFCEKYQPEQEALQEKIINAQKLLPQVEIDYDLRIKISEVCSALDVDGLRGDIVTNRAA
KALAAFEGRTTVTVDDIRRVITLALRHRLRKDPLESIESGYKVEKAFNRVFGLEVSEEN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccctccaagcacctccaaagactcgtcgcgtaattttccccttcaccgcg
attgtaggtcaagaagaaatgaaactcgctctcatcctcaatgtaatcgatccgaaaatt
ggcggggtaatgattatgggcgatcgcggcactggcaaatcgacgacaattcgggcctta
gccgatttattgccagaaattgaagtcgtcgccgacgatcccttcaattccgatccctac
gatcccgatctaatgagcgatcgcgttcgggagcaactagagaaacaaattcccctacaa
attgtcaaaaagaaagttcccatggttgacttgcctctaggagccactgaagatagagtt
tgcggcacgatcgacattgaaaaagccctctccgaaggggtgaaagcctttgaacccgga
ctgctggcaaaagctaatcgaggcattctctacgtcgatgaagtcaacttgctcgacgat
cacctcgtagacgttttattggattctgccgctagcggttggaataccgtcgaacgagaa
ggaatttccattcgccaccccgcccgtttcgtgctggtaggttccggcaacccagaagaa
ggagaattgcgacctcagttgctcgatcgctttggcatgcacgccgaaattcacaccgtc
aaagaacccgcgctgagagtgcaaatcgtcgagcagcgctccgaatttgacagcaatccc
caaaaattctgcgaaaaataccaacccgaacaagaagcgctgcaagagaagattattaac
gctcaaaaacttctgccccaagtcgaaatcgattacgatttgcgcattaaaatttccgaa
gtttgttccgctctcgatgtcgatggcttgagaggagatatcgtcaccaatcgcgccgct
aaagccctagcagcctttgaagggcgcacgaccgtgacggtagacgatattcgtcgggta
attaccttggctctgcggcaccgactgcgcaaagaccccctggagtcgatcgaatccggc
tataaagtcgaaaaagccttcaatcgggtattcggtttggaagtgtcagaagaaaactag

DBGET integrated database retrieval system