KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1178Help
Entry
Ple7327_1178      CDS       T02367                                 

Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:plp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249430..1250509)
Genome map
AA seq 359 aa AA seqDB search
MTATLQAPPKTRRVIFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVADDPFNSDPYDPDLMSDRVREQLEKQIPLQIVKKKVPMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDSNP
QKFCEKYQPEQEALQEKIINAQKLLPQVEIDYDLRIKISEVCSALDVDGLRGDIVTNRAA
KALAAFEGRTTVTVDDIRRVITLALRHRLRKDPLESIESGYKVEKAFNRVFGLEVSEEN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccctccaagcacctccaaagactcgtcgcgtaattttccccttcaccgcg
attgtaggtcaagaagaaatgaaactcgctctcatcctcaatgtaatcgatccgaaaatt
ggcggggtaatgattatgggcgatcgcggcactggcaaatcgacgacaattcgggcctta
gccgatttattgccagaaattgaagtcgtcgccgacgatcccttcaattccgatccctac
gatcccgatctaatgagcgatcgcgttcgggagcaactagagaaacaaattcccctacaa
attgtcaaaaagaaagttcccatggttgacttgcctctaggagccactgaagatagagtt
tgcggcacgatcgacattgaaaaagccctctccgaaggggtgaaagcctttgaacccgga
ctgctggcaaaagctaatcgaggcattctctacgtcgatgaagtcaacttgctcgacgat
cacctcgtagacgttttattggattctgccgctagcggttggaataccgtcgaacgagaa
ggaatttccattcgccaccccgcccgtttcgtgctggtaggttccggcaacccagaagaa
ggagaattgcgacctcagttgctcgatcgctttggcatgcacgccgaaattcacaccgtc
aaagaacccgcgctgagagtgcaaatcgtcgagcagcgctccgaatttgacagcaatccc
caaaaattctgcgaaaaataccaacccgaacaagaagcgctgcaagagaagattattaac
gctcaaaaacttctgccccaagtcgaaatcgattacgatttgcgcattaaaatttccgaa
gtttgttccgctctcgatgtcgatggcttgagaggagatatcgtcaccaatcgcgccgct
aaagccctagcagcctttgaagggcgcacgaccgtgacggtagacgatattcgtcgggta
attaccttggctctgcggcaccgactgcgcaaagaccccctggagtcgatcgaatccggc
tataaagtcgaaaaagccttcaatcgggtattcggtttggaagtgtcagaagaaaactag

DBGET integrated database retrieval system