KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1355Help
Entry
Ple7327_1355      CDS       T02367                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ple7327_1355
Enzymes [BR:plp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Ple7327_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1435063..1436808
Genome map
AA seq 581 aa AA seqDB search
MSEANKQFEYFSLRVKPLLETLYDKKTAAHFLERLYYLLKEHFADRVDENLNKWTENNVQ
LITYGDSILKEGEKPLVTLDRFLDEHIRDTLTGVHILPFFPYSSDDGFAVIDYLKVDPQL
GDWEDIQRIAGKFNLMVDLVINHVSSQHAWFEQFKQGIKPGCDYFIEVDPATDLSQVVRP
RSTPLLAKVNTVKGEKHVWATFSEDQIDVNFANPEVLLEYVKIILFYIKKGAKYIRLDAV
GFLWKKIGTSCIHLPETHTVIRLLREIVQMLDPMVALISETNVPNRENLSYFGNRNEAHM
IYNFSLPPLILNALLQGKSDHLKTWMMSMPPAPIGCAYLNFTASHDGIGLRPTEGLLYED
EYQTLLEKMQEFGGKISMRNKSDGTEVPYEVNISFFDAMQGTVKGKDKWQIQRFLCSQTI
MLALEGIPAFYIHSLLATPNDLEGVEKNGRNRSINRYKWNYEELEKRLKNPKSPQSIVLK
ELSRRIKIRRKQPAFHPNATQYTLHPLNKALFVFWRQSIYRDQSIFCINNLSDRTQKLRL
SDLNLFIIDPWCDLLSGHPIENLHDKFTLKPYQCAWITNKF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcaaacaagcaatttgaatatttttccctccgagtcaagcctctcctagaa
actctctacgataaaaaaactgccgcccattttttagagcggttgtactatctcctcaaa
gaacattttgccgatcgcgtcgatgaaaatttaaataaatggacggaaaataacgttcaa
ctcataacctacggagatagtatcctcaaagaaggcgaaaaacccttagttacgctcgat
cgctttttagacgaacacattcgagatacactgacaggcgttcatattctgccttttttt
ccctacagttccgacgatgggtttgctgtcatcgactatctcaaagtcgatccacaatta
ggagattgggaagatattcaacggattgctggaaaatttaatttaatggtcgatctcgtc
atcaatcacgtttccagccaacatgcttggtttgagcaatttaagcaaggaattaagccg
ggatgcgattattttatcgaagtcgatcccgctaccgatttatctcaagtcgttcgtcct
cgcagtacgccattgctagctaaagtcaatacggttaagggagaaaaacatgtctgggca
acctttagcgaagatcaaatcgatgttaattttgccaatccagaggttttattggagtac
gttaaaattattcttttctatatcaagaaaggggcaaaatatattcgactcgatgccgta
ggatttctctggaaaaaaattggcacttcctgcattcatttaccagaaactcataccgtt
atcaggcttctacgggaaatcgtacaaatgctcgatccgatggtagctttaatatcggaa
actaacgtccccaaccgagaaaatctgagttattttggcaatcgaaatgaggcgcacatg
atttataatttcagccttcctcccctcattttgaatgctttattacaaggaaaatccgat
catttaaaaacatggatgatgagcatgcctcctgcgcctattgggtgtgcgtatctgaat
tttaccgcttcccacgatggaattggtctgcgtcctactgaaggattgttatacgaagac
gagtatcaaaccctgttagaaaagatgcaggaattcggcggcaaaatcagcatgagaaat
aaatccgacggaaccgaagttccttatgaggtcaatatttctttcttcgacgcgatgcaa
ggtactgttaaaggtaaggataaatggcaaattcagcgctttctttgttcgcaaacgatt
atgttagctctcgaaggaattccagctttttatattcatagtttattggcaacgcccaac
gaccttgaaggcgtggaaaaaaacggaagaaatcgctctattaaccgctacaaatggaat
tatgaagagttagaaaaacgcttaaaaaatcccaagtctcctcagtcaatcgtattaaaa
gaactcagccgacgcatcaaaattcgtcgcaaacaacctgcatttcatcccaatgcaact
caatatactttgcatcccttaaataaagcgctgttcgtcttctggagacaaagcatttat
cgcgatcaaagtattttctgcattaataatttgagcgatcgcactcaaaaacttcgtctc
tctgacttaaatttatttattatcgatccctggtgcgatctcctaagcgggcatccaatc
gaaaatctccacgacaaatttaccctcaagccctatcaatgtgcttggattactaataag
ttttaa

DBGET integrated database retrieval system