KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1440Help
Entry
Ple7327_1440      CDS       T02367                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:plp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:plp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535281..1536108
Genome map
AA seq 275 aa AA seqDB search
MTKQLITPESKQELTLSWASVAFFTVIHALALLAPWFFSWSALGVAIALHWLFGSIGICL
GYHRLLTHRSLQVPQWLEYVIATIGAMALQGGPIFWVSSHRLHHAYTEDEQKDPYSAKRG
FWWSHMLWLLYPREAFFNYESYKKYAPDLDRHAYYRWLNRNFLWLQIPLGLLLYGLGGWS
FVIYGMFLRAVLLWHSTWLINSATHVRGYRNFPVEDGSRNLWWAAILTYGEGWHNNHHAH
PRIAKAGQRWWEIDPTWWVIQGLKMLGLAKNIVTS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaattgattacgccagagagcaagcaggagcttacgctttcctgggcaagt
gtggcttttttcaccgtcattcatgcattagcgttgttggcgccgtggttcttttcctgg
tcggctttaggcgtagcgatcgcgcttcactggctgtttggtagtatcggtatatgtttg
gggtatcatcgccttttaacccatcgcagccttcaggtgccgcaatggttggaatatgtc
atagcgaccatcggggctatggcgctacaaggagggccgatcttttgggtgtcgtcgcat
cgcttacatcacgcttatactgaggatgaacagaaagacccctattcagcaaaacggggt
ttttggtggagccatatgctttggctgttgtacccacgagaagcttttttcaactacgaa
tcctataaaaaatatgcgcccgatttagaccgacacgcctattatcgttggttgaatcgt
aacttcctgtggcttcagattcctttgggtttgctgttgtacggtttgggcggatggtct
tttgtcatctatggcatgtttttgagagcagttttactgtggcacagcacctggttaatt
aactccgctacccatgtacggggatatcgtaattttcctgtagaggacggctctcgcaat
ctttggtgggcagcaattttaacttatggagaaggttggcataataaccatcacgctcat
ccccgcatagccaaagccggacagcgttggtgggaaatcgatccgacttggtgggtaatt
caaggattaaaaatgttaggtctagccaagaacatcgtcacaagctga

DBGET integrated database retrieval system