KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1637Help
Entry
Ple7327_1637      CDS       T02367                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ple7327_1637
Enzymes [BR:plp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Ple7327_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1754327..1755523)
Genome map
AA seq 398 aa AA seqDB search
MTEQQPFQPPNSQLNGHSTEAQRALQREAQLPMTGWQQEVSRGLEFGLEAAQSIRDRTIP
TFSRGELPHYAGINTFLKAPYLEDVRKVGEYDVAILGVPHDSGTTYRPGTRFGPQGIRRI
SALYTPYNFEMGVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHVFSSGAFPIILGG
DHSIGFPTVRGICQHLGDKKMGIIHFDRHVDTQETDLDERMHTCPWFHATNIKNAPAKNL
VQLGIGGWQVPRQGVKVCRERATNILTVTDITEIGLDAAIDFALERALDGTDCVYISFDI
DCIDAGFVPGTGWPEPGGLLPREALYLLRKIVRNAPVCGLEVVEVSPPYDVSDMTALMAT
RVICDTMAHLVISGQLPRKEKPSYIHPEAQPELVAEWQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaacaaccttttcaacctccaaattctcaactgaacggtcattctaccgag
gcacaaagagccttacaaagggaagcacagctaccgatgacggggtggcaacaagaggtt
tctagaggtttagaatttggtttagaagcggcacagagcattcgcgatcgcacgattcca
accttctctcgcggtgaattgccccactatgcaggcattaatacatttctcaaagcaccc
tatttagaggacgttcgtaaggttggggaatacgatgtcgctatccttggcgttcctcac
gattcaggcacgacttatcgtccgggaactcgttttggtcctcaaggcattcgtcgcatt
tctgctctttatactccttacaattttgaaatgggggtcgatttgcgagagcaaattacc
ttatgcgatgtcggggatatttttaccattccagctaataatgaaaagtccttcgatcaa
atttcaaaaggaattgcccacgtctttagttcgggtgcatttcctattattttaggcggc
gatcattcgattggttttcctaccgttcgcggaatttgtcagcatttaggcgataaaaaa
atgggcattattcacttcgatcgccacgtcgatacccaagaaaccgatttagacgaacgg
atgcatacttgtccttggtttcatgccactaatataaagaatgctcctgcaaaaaaccta
gttcaattgggaatcggcggctggcaagttccccgtcaaggcgtgaaggtttgtcgagag
agagcgactaatattttaaccgttactgacatcacagaaataggcttagatgctgccata
gatttcgctctagaacgagccttagatggaactgattgtgtctatatcagtttcgatatt
gactgtatcgacgcgggatttgttcctggaactggatggcccgaacccggcggtttattg
cctcgcgaagcgctttatttattaagaaaaattgttcgcaatgctcctgtttgcggacta
gaagttgtcgaagtttcgcctccctatgatgtcagcgatatgacggctttgatggcaact
cgcgtcatatgcgatacgatggctcatttagttatttcgggacagttaccaagaaaagaa
aagccttcttatatccacccagaagcacaaccagaattagtagcagaatggcaataa

DBGET integrated database retrieval system