KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1659Help
Entry
Ple7327_1659      CDS       T02367                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ple7327_1659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ple7327_1659
   00620 Pyruvate metabolism
    Ple7327_1659
   00650 Butanoate metabolism
    Ple7327_1659
  Lipid metabolism
   00071 Fatty acid degradation
    Ple7327_1659
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ple7327_1659
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ple7327_1659
   00626 Naphthalene degradation
    Ple7327_1659
Enzymes [BR:plp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ple7327_1659
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ple7327_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774284..1776965)
Genome map
AA seq 893 aa AA seqDB search
MKVTNIQELKELIQQVKIAQKRYATFTQEQVDFIFKKAALAANSARIPLAKMAVVETGMG
IIEDKVIKNHFASEIIYNKYKNDKTCGVIEEDKSFGLQKIAEPVGILAGIVPITNPTATA
IFKSLIALKTRNGIIFSPHPKAKDCTIEAAKIVREAAIAAGAPDNIIGWIDDPSVPLSQA
LMQHPDINLILATGGPSMVKAAYSSGRPSLGVGAGNTPALIDETAHIKMAVSSIILSKTF
DNGTICASEQSVIVASQIYREVKHEFTERGAYFLNAQEREKVANLILVEGRINPDIVGQP
VKKIAQLAGFSIPDDTRLLIGEVEKIGTDEPFSYEKLSPILAMYRATDFEDGVEKAEKLV
QFGGRGHTAVLYTAPGNQEHIKRFENKVETARVLINTPSSQGAIGDIFNFRLDPSLTLGC
GTWGGNSISGNVEPTHLLNIKTVAERRENMLWFRIPPKIYFKHGSLPVAIRELVGKRRAF
IVTDKPIFDLGMTGALEEVLDEIGLRYDIFYDVEPDPSLNTVRRGLELINTFNPDVIIAM
GGGSPMDAAKIMWLLYEHPEIEFEGLAMRFMDIRKRVYELPPLGEKAILVAVPTTSGTGS
EVTPFAVVSDRHNNIKYPLADYALTPTMAIVDPELVLGMPKKLTAYGGIDALTHALEAFV
SVLASEYTNGLALEAIRLLFKYLPSAYKNGASDPKAREKVHYAATMAGMAFANGFLGICH
SMAHQLGGMFHIPHGLANALMISYVIRYNATDAPFKQATFSQYKYPNAMWRYARIANYLG
LGGNTEEEKIDRLIEAVEDLKRELEIPAAIKDVIHESETEFYAKLDELADRAFDDQCTGS
NPRYPLINDLRKLLIDAYHGNSPLNPSPNGNGHAGAVEIKPDPQPIFSVLKRH
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaccaacattcaagaactaaaagaactcatccaacaggttaaaatcgctcaa
aaacgatacgctactttcacccaagaacaagtcgatttcatcttcaaaaaagctgcactc
gctgccaattcggcacgcattcctttggcaaaaatggctgtagttgagacgggaatggga
ataattgaagacaaagtaatcaaaaatcacttcgcttcagaaattatctacaacaaatac
aaaaacgacaaaacctgcggcgttattgaagaggataaatcctttggattgcagaaaatt
gccgaacccgtcggtatcctagcaggaatcgttcccatcactaaccccacggcgacagct
attttcaaatccctcattgccctaaaaacccgcaatggcattatcttctctccccatccc
aaagccaaagattgcaccatcgaggctgccaaaatcgtccgagaagccgccatagcagcg
ggagcgcccgacaatattatcggttggattgacgacccctcagttcctctatcccaggct
ttgatgcaacatcccgatattaacctcatcctagccacgggaggtccgagcatggtcaaa
gctgcctattcttcgggtcgtccctcgctgggagtgggtgcgggcaatacgccagccttg
attgacgaaacggctcacattaaaatggcggtttcttcgattatattgagcaaaaccttt
gacaatggtacgatctgcgccagcgaacagtcagtcatcgtcgccagtcagatttatcgc
gaagtcaagcacgaatttaccgaacgaggagcctattttctcaacgcccaagaacgggaa
aaagtggctaatctgattctggttgagggacgcatcaatcccgatatcgtcggtcaaccc
gtcaagaaaatcgcccaattagcgggtttttcaattcccgacgatacccgcttgttaatc
ggcgaagtggaaaaaattggcacggacgaaccattctcctatgaaaaattgtctcccatc
ctggcaatgtaccgggcgacagattttgaagatggagtcgagaaagctgagaaattagtg
caattcggcggtaggggacatacagcggtactctataccgcgccaggcaatcaagagcat
atcaaacgctttgaaaacaaagtagaaacggcacgggtattgatcaatacgccgtcttct
caaggcgcgattggcgatattttcaacttccgtctcgatccttcgctcaccctcggttgc
ggcacttggggcggcaattcaattagcggaaacgtcgaaccgacccatttactcaatatt
aaaacggtagcggaacggagagaaaatatgctttggttccgcattcccccgaaaatctat
tttaaacacggctcgcttcccgttgccattcgggagttagtcggaaaacgaagggcgttt
attgtcaccgataaaccgatttttgatttggggatgacgggtgccttagaagaggtactc
gatgaaattgggttgcgctatgacatattttacgatgtcgaacccgatccctctctcaat
accgttcgtcgaggattagaactaataaatacgttcaatcccgacgtaattatcgccatg
ggcggcggttctcccatggatgcggcaaagattatgtggctgctgtacgaacatccagag
atcgaatttgaaggacttgccatgcggtttatggatatccgcaagcgagtgtacgagttg
ccgcctttgggagagaaagcaattctggttgccgttcctactacatcgggaacgggttcg
gaagtaactccctttgctgtcgtgagcgatcgccacaataatatcaagtatcctttagcc
gattatgccttaacgccaacgatggcgatcgtcgatccggagttggtgttaggtatgccc
aaaaaactaacggcttatgggggtatcgacgcactcactcatgcactagaagcgtttgtc
tcggtattggcttcagaatataccaatggtcttgctttagaagcgattcgcttgctcttt
aaatatcttcccagtgcctataaaaatggggcaagcgatcccaaggcgcgggagaaggtt
cactatgcggcaacgatggcagggatggcgtttgccaatggatttttaggaatttgtcac
tcaatggcgcaccagttggggggaatgtttcacatcccccacgggttggcaaatgcactg
atgatttcctacgtcatccgctacaacgccacggatgcaccatttaagcaagccactttt
tctcaatataaatatcctaatgccatgtggcgctatgctcgcattgctaattatttggga
ttgggaggcaatactgaagaagaaaagatcgatcgcttgatcgaagcggtagaagatctt
aagcgcgagttagagattccggcagccatcaaagatgtcatccacgaaagcgaaacggaa
ttttatgccaagctagacgaactcgcagatcgcgcttttgacgatcagtgtaccggatct
aacccgcgctatccgctgattaacgatctcaggaaactgttaatcgatgcctatcacggc
aattcgccccttaatcccagtcctaatggtaacggtcatgcaggtgcagtagaaatcaag
cccgatccgcaaccgatcttttctgttcttaagcggcattag

DBGET integrated database retrieval system