KEGG   Pleurocapsa sp. PCC 7327: Ple7327_1913Help
Entry
Ple7327_1913      CDS       T02367                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
plp00790  Folate biosynthesis
plp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ple7327_1913
Enzymes [BR:plp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ple7327_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF FlbD
Motif
Other DBs
NCBI-ProteinID: AFY77258
UniProt: K9T4B9
Position
complement(2048816..2049544)
Genome map
AA seq 242 aa AA seqDB search
MTITSSNGFNRPNSSSMNRPNALNPNLIERVKSRPDRNTHDGQEAQFHAASVENQDRMIE
AVRTMLESVGEDPEREGLLKTPKRVAEAMQFLTQGYTQSLEELVNGAIFDEGHNEMVLVR
DIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAI
QTILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQDDQKTREEFLNLIRHRPN
FM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacaataacatcttctaacggttttaatcgtcccaattcatctagcatgaatcgtccc
aatgctctaaatcccaatctcatagaacgcgtcaagagcagacccgatcgcaatactcac
gacggtcaggaagctcaattccacgctgcttccgtagaaaaccaagacagaatgatagaa
gcagtgcgaacgatgctcgaatcagttggcgaagatccagagcgtgagggactgctgaaa
acgcctaagcgagtcgcagaagcgatgcaatttctgactcagggctacacccaatccctc
gaagaactggtcaacggtgccatctttgacgaaggacataatgagatggtgttggtacgg
gatatcgatttcttcagcctctgcgaacaccacatgttaccttttatgggcagagcgcac
gttgcctacattcccaatcaaaaagtggtgggcttgagcaaactcgctcgcattgtagaa
atgtactcccgccgccttcaggtacaagaacgcctgactcgtcaaattgccgaagcaatt
cagaccatcttagatcctcaaggcgttgccgtcgtcatggaagctacccacatgtgtatg
gtgatgagaggcgtgcaaaagcccggttcttggacggtcacgagtgctatggtgggagtt
tttcaagacgatcagaaaactcgcgaagaattcttgaatttaattcgccatcgacccaat
tttatgtaa

DBGET integrated database retrieval system