KEGG   Pleurocapsa sp. PCC 7327: Ple7327_2016Help
Entry
Ple7327_2016      CDS       T02367                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
plp  Pleurocapsa sp. PCC 7327
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:plp00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:plp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2179208..2180662)
Genome map
AA seq 484 aa AA seqDB search
MYVQKNIKISQYLEDKAINSLHSSNHPLSQPEDEQPILQIWGRASLEGEVRISGAKNSAL
AIMAGVLLCSDECRLQNVPILVDVTRMEQILEALGVKLNRQGNILDVDASNIGKSQAPYD
LVSQMRASFFVIGPLLTRLGVASVPLPGGCAIGARPVDLHVRGLQAMGADVRIEHGMVHA
CVRGRRSRLQGAKIYLDYPSVGATETLMMAATLAEGETIIENAAQEPEVEDLANFCRAMG
AQISGAGTNTILISGVDRLHETDYSIIPDRIEAGTFLVAGAITDSEISLYPVIPEHLAPV
IAKLQEIGTQVVTDAPNRLRVVPGALRATDIETLPYPGFPTDMQAQFMALLAIAEGNSVI
SETVFENRLRHVAELNRMGADIRVKGNHAIVKGVPRLLGAPVMATDLRASAALVLAGLTA
EGKTIVQGLHHLDRGYDNLEGKLSQLGAKLRRVTPQTQTSANISPIGQPNSQLSVCTSQL
SPHQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtccaaaaaaacattaagatttcccaatatttggaggataaagccataaactcc
ctgcatagttccaatcatcccctctcccagcccgaagacgagcaacccattttacagatc
tggggtagagcgtctctcgaaggagaagtccgaattagcggcgccaaaaattctgcccta
gcgatcatggcaggggtactcctatgttccgatgaatgtcggcttcagaacgtgccgatc
ttagtagatgtgacgcggatggagcaaattctggaagctctaggagtcaagctcaacagg
cagggcaacattttagatgtggatgctagcaatattgggaaatcccaagcgccttacgat
cttgtctctcaaatgagagctagtttttttgtcattggtcctttgttgactagactaggc
gttgctagcgttcctctgccagggggatgcgcgatcggagcgagacctgtcgatctccac
gttcgcggtttgcaagcgatgggagcagacgttcgcatcgaacacggcatggttcatgct
tgcgtcaggggaagaagaagcagattgcagggagcaaaaatttacttagactatcccagc
gttggcgctacagaaacgctgatgatggcagccactttagcggaaggcgaaactatcatt
gaaaatgccgctcaagagccagaagtcgaagatttggctaatttctgtcgagcaatggga
gcgcaaattagcggcgctggcaccaatacgattcttatttctggagtcgatcgcctgcac
gaaacggattattctatcatcccggatcgcattgaagcgggaacttttctcgtagctgga
gcgattactgactcagaaattagcctatatcccgtcattcccgaacacttggctcccgta
attgccaaattgcaagagatcggcactcaagtcgttacagatgcccccaatcgcttgcgc
gtcgtacctggcgccctgcgggcgactgatatcgaaacgcttccctatccaggatttccc
acggatatgcaagcacagtttatggcacttctcgccattgccgaaggaaacagcgtcatt
agcgagacggtgtttgaaaaccgcctgcgccacgtggcagaattaaatcgcatgggagcc
gacattcgcgttaaaggaaatcacgcgatcgtcaaaggcgtgcccaggttattgggcgct
cccgtcatggcaaccgatttacgcgcttcagccgctttggtactggcaggtttaaccgcc
gaaggcaagacaatcgttcaaggattgcatcatttagaccgagggtacgacaatctagaa
ggaaagctgagtcagttgggagccaaacttcgcagagttacgcctcagacgcagacttca
gccaatatttcgccaattggtcaacccaattcgcaattatcggtttgcacttcgcaatta
tcacctcatcaataa

DBGET integrated database retrieval system